The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb |
| molecule keywords |
16S RIBOSOMAL RNA
|
| molecule tags |
Ribosome
|
| source organism |
Escherichia coli
|
| total genus |
6
|
| structure length |
60
|
| sequence length |
60
|
| ec nomenclature | |
| pdb deposition date | 2000-12-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| N | PF00253 | Ribosomal_S14 | Ribosomal protein S14p/S29e |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | 30s Ribosomal Protein S14; Chain N | 30s Ribosomal Protein S14; Chain N |
#chains in the Genus database with same CATH superfamily 2HHH N; 5FLX d; 4DUZ N; 4B3T N; 1N32 N; 4LF7 N; 5BR8 N; 1XMQ N; 2UXB N; 4DR7 N; 3J7A T; 2UUC N; 4DR4 N; 4DV7 N; 2E5L N; 4KHP N; 2ZM6 N; 4DV1 N; 4JI2 N; 4DR6 N; 4JYA N; 5LMU N; 4LF5 N; 1FJG N; 4B3M N; 1I94 N; 4DV3 N; 4DR2 N; 4DV6 N; 2UU9 N; 2UUA N; 4JI1 N; 3OTO N; 4NXM N; 4DR3 N; 4DR1 N; 3J81 d; 1IBK N; 4DV0 N; 5A2Q d; 4LF9 N; 4YHH N; 4JI7 N; 1XNR N; 4JI6 N; 4OX9 N; 1J5E N; 4B3R N; 4JI3 N; 2UXC N; 1IBL N; 1N33 N; 2UXD N; 4JI5 N; 4X62 N; 1HNZ N; 3JAM d; 4JI4 N; 1HR0 N; 4X64 N; 4DR5 N; 4LFA N; 1IBM N; 5IT9 d; 4YY3 N; 1XNQ N; 4LF6 N; 1N36 N; 4DV2 N; 4LF8 N; 4GKJ N; 2VQF N; 3J80 d; 4JI8 N; 4DV5 N; 3T1H N; 1XMO N; 4LF4 N; 1HNX N; 4AQY N; 2UUB N; 4DV4 N; 2VQE N; 4GKK N; 4K0K N; 2F4V N; 4LFC N; 5IWA N; 4DUY N; 4B3S N; 4X65 N; 5LMN N; 4LFB N; 1HNW N; 4JV5 N; 4X66 N; 4NXN N; 3T1Y N; 4JI0 N; 1N34 N; #chains in the Genus database with same CATH topology 2HHH N; 5FLX d; 4DUZ N; 4B3T N; 1N32 N; 4LF7 N; 5BR8 N; 1XMQ N; 2UXB N; 4DR7 N; 3J7A T; 2UUC N; 4DR4 N; 4DV7 N; 2E5L N; 4KHP N; 2ZM6 N; 4DV1 N; 4JI2 N; 4DR6 N; 4JYA N; 5LMU N; 4LF5 N; 1FJG N; 4B3M N; 1I94 N; 4DV3 N; 4DR2 N; 4DV6 N; 2UU9 N; 2UUA N; 4JI1 N; 3OTO N; 4NXM N; 4DR3 N; 4DR1 N; 3J81 d; 1IBK N; 4DV0 N; 5A2Q d; 4LF9 N; 4YHH N; 4JI7 N; 1XNR N; 4JI6 N; 4OX9 N; 1J5E N; 4B3R N; 4JI3 N; 2UXC N; 1IBL N; 1N33 N; 2UXD N; 4JI5 N; 4X62 N; 1HNZ N; 3JAM d; 4JI4 N; 1HR0 N; 4X64 N; 4DR5 N; 4LFA N; 1IBM N; 5IT9 d; 4YY3 N; 1XNQ N; 4LF6 N; 1N36 N; 4DV2 N; 4LF8 N; 4GKJ N; 2VQF N; 3J80 d; 4JI8 N; 4DV5 N; 3T1H N; 1XMO N; 4LF4 N; 1HNX N; 4AQY N; 2UUB N; 4DV4 N; 2VQE N; 4GKK N; 4K0K N; 2F4V N; 4LFC N; 5IWA N; 4DUY N; 4B3S N; 4X65 N; 5LMN N; 4LFB N; 1HNW N; 4JV5 N; 4X66 N; 4NXN N; 3T1Y N; 4JI0 N; 1N34 N; #chains in the Genus database with same CATH homology 2HHH N; 5FLX d; 4DUZ N; 4B3T N; 1N32 N; 4LF7 N; 5BR8 N; 1XMQ N; 2UXB N; 4DR7 N; 3J7A T; 2UUC N; 4DR4 N; 4DV7 N; 2E5L N; 4KHP N; 2ZM6 N; 4DV1 N; 4JI2 N; 4DR6 N; 4JYA N; 5LMU N; 4LF5 N; 1FJG N; 4B3M N; 1I94 N; 4DV3 N; 4DR2 N; 4DV6 N; 2UU9 N; 2UUA N; 4JI1 N; 3OTO N; 4NXM N; 4DR3 N; 4DR1 N; 3J81 d; 1IBK N; 4DV0 N; 5A2Q d; 4LF9 N; 4YHH N; 4JI7 N; 1XNR N; 4JI6 N; 4OX9 N; 1J5E N; 4B3R N; 4JI3 N; 2UXC N; 1IBL N; 1N33 N; 2UXD N; 4JI5 N; 4X62 N; 1HNZ N; 3JAM d; 4JI4 N; 1HR0 N; 4X64 N; 4DR5 N; 4LFA N; 1IBM N; 5IT9 d; 4YY3 N; 1XNQ N; 4LF6 N; 1N36 N; 4DV2 N; 4LF8 N; 4GKJ N; 2VQF N; 3J80 d; 4JI8 N; 4DV5 N; 3T1H N; 1XMO N; 4LF4 N; 1HNX N; 4AQY N; 2UUB N; 4DV4 N; 2VQE N; 4GKK N; 4K0K N; 2F4V N; 4LFC N; 5IWA N; 4DUY N; 4B3S N; 4X65 N; 5LMN N; 4LFB N; 1HNW N; 4JV5 N; 4X66 N; 4NXN N; 3T1Y N; 4JI0 N; 1N34 N;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
