The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
81
|
sequence length |
257
|
structure length |
257
|
Chain Sequence |
AVRGSIIANMLQEHDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWARLYTRLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGYGGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase, membrane protein
|
molecule keywords |
OUTER MEMBRANE PHOSPHOLIPASE A
|
publication title |
Structural investigations of the active-site mutant Asn156Ala of outer membrane phospholipase A: function of the Asn-His interaction in the catalytic triad.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
81
|
structure length |
257
|
sequence length |
257
|
ec nomenclature |
ec
3.1.1.32: Phospholipase A(1). |
pdb deposition date | 2001-05-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02253 | PLA1 | Phospholipase A1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Outer membrane phospholipase (ompla); Chain C | Phospholipase A1 |
#chains in the Genus database with same CATH superfamily 1QD6 C; 1FW3 A; 5DQX A; 1QD5 A; 1ILD A; 1FW2 A; 1IM0 A; 1ILZ A; #chains in the Genus database with same CATH topology 1TLW A; 1TLZ A; 1QD6 C; 1FW3 A; 5DQX A; 1QD5 A; 1TLY A; 1ILD A; 1FW2 A; 1IM0 A; 1ILZ A; #chains in the Genus database with same CATH homology 1QD6 C; 1FW3 A; 5DQX A; 1QD5 A; 1ILD A; 1FW2 A; 1IM0 A; 1ILZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...