The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
112
|
structure length |
112
|
Chain Sequence |
EDKYTDKYDNINLDEILANKRLLVAYVNCVMERGKCSPEGKELKEHLQDAIENGCKKCTENQEKGAYRVIEHLIKNEIEIWRELTAKYDPTGNWRKKYEDRAKAAGIVIPEE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Lipid transport
|
molecule keywords |
Chemosensory Protein CSP2
|
publication title |
Solution structure of a chemosensory protein from the moth Mamestra brassicae
pubmed doi rcsb |
source organism |
Mamestra brassicae
|
total genus |
24
|
structure length |
112
|
sequence length |
112
|
ec nomenclature | |
pdb deposition date | 2001-09-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03392 | OS-D | Insect pheromone-binding family, A10/OS-D |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Antennal chemosensory protein a6 | Insect odorant-binding protein A10/Ejaculatory bulb-specific protein 3 |
#chains in the Genus database with same CATH superfamily 2GVS A; 1N8V A; 1K19 A; 1KX8 A; 1N8U A; 2JNT A; 1KX9 A; #chains in the Genus database with same CATH topology 2GVS A; 1N8V A; 1K19 A; 1KX8 A; 1N8U A; 2JNT A; 1KX9 A; #chains in the Genus database with same CATH homology 2GVS A; 1N8V A; 1K19 A; 1KX8 A; 1N8U A; 2JNT A; 1KX9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...