1M06F

Structural studies of bacteriophage alpha3 assembly, x-ray crystallography
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
422
structure length
422
Chain Sequence
REIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLAIDSKVDFFTFYIPHRHVYGDQWIQFMRDGVNAQPLPSVTCNRYPDHAGYVGTIVPANNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARYGFRCCHLKNIWSAPLPPETKLAEEMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMHTDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEHHYLAGKSQLTYTDLAGDPALIGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYVNFKYHDLHGFPFLDDAPGTSTGDNLQEAILVRHQDYDACFQSQQLLQWNKQARYNVSVYRHMPTVRDSIMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/dna
molecule keywords Capsid Protein
publication title Structural Studies of Bacteriophage alpha3 Assembly
pubmed doi rcsb
source organism Enterobacteria phage alpha3
total genus 107
structure length 422
sequence length 422
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02305 Phage_F Capsid protein (F protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.169.10 Mainly Beta Sandwich Bacteriophage G4 Capsid Proteins Gpf, Gpg, Gpj, subunit 1 Microviridae F protein 1m06F00
1RB8F 2BPA1 1CD3F 1M06F 1AL0F 1GFF1
chains in the Genus database with same CATH superfamily
1RB8F 2BPA1 1CD3F 1M06F 1AL0F 1GFF1
chains in the Genus database with same CATH topology
1RB8F 2BPA1 1CD3F 1M06F 1AL0F 1GFF1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RB8 F;  2BPA 1;  1CD3 F;  1M06 F;  1AL0 F;  1GFF 1; 
#chains in the Genus database with same CATH topology
 1RB8 F;  2BPA 1;  1CD3 F;  1M06 F;  1AL0 F;  1GFF 1; 
#chains in the Genus database with same CATH homology
 1RB8 F;  2BPA 1;  1CD3 F;  1M06 F;  1AL0 F;  1GFF 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...