The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
112
|
structure length |
112
|
Chain Sequence |
IMPPEAEIVPLPKLPMGALVPTAYGYIISDVPGETISAAISVAIPKDKSLCGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVEKLGCAFAAAALWYK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii:
Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Methanocaldococcus jannaschii
|
molecule keywords |
PYRUVOYL-DEPENDENT ARGININE DECARBOXYLASE BETA CHAIN
|
total genus |
16
|
structure length |
112
|
sequence length |
112
|
chains with identical sequence |
D, F, H, J, L
|
ec nomenclature |
ec
4.1.1.19: Arginine decarboxylase. |
pdb deposition date | 2002-09-20 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bba) Sandwich | Pyruvoyl-Dependent Histidine Decarboxylase; Chain B | Pyruvoyl-Dependent Histidine Decarboxylase, subunit B |
#chains in the Genus database with same CATH superfamily 1PYA B; 1IBW B; 1HQ6 B; 1IBV B; 1N13 B; 1N2M A; 2QQD B; 1IBU B; 1IBT B; 1MT1 B; 2QQC B; 2QQD C; #chains in the Genus database with same CATH topology 1PYA B; 2AI6 A; 1IBW B; 2NMM A; 1HQ6 B; 1IBV B; 1N13 B; 1N2M A; 2QQD B; 1IBU B; 1IBT B; 2OZX A; 2OZW A; 1MT1 B; 2HW4 A; 2QQC B; 2QQD C; #chains in the Genus database with same CATH homology 1PYA B; 1IBW B; 1HQ6 B; 1IBV B; 1N13 B; 1N2M A; 2QQD B; 1IBU B; 1IBT B; 1MT1 B; 2QQC B; 2QQD C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...