1R0DA

Hip1r thatch domain core
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
194
structure length
194
Chain Sequence
DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural definition of the F-actin-binding THATCH domain from HIP1R
pubmed doi rcsb
molecule keywords Huntingtin Interacting Protein 12
molecule tags Structural protein
source organism Homo sapiens
total genus 80
structure length 194
sequence length 194
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1410.10 Mainly Alpha Up-down Bundle I/LWEQ domain I/LWEQ domain 1r0dA00
3AY5A 2JSWA 1R0DA
chains in the Genus database with same CATH superfamily
3AY5A 2JSWA 1R0DA
chains in the Genus database with same CATH topology
3AY5A 2JSWA 1R0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AY5 A;  2JSW A;  1R0D A; 
#chains in the Genus database with same CATH topology
 3AY5 A;  2JSW A;  1R0D A; 
#chains in the Genus database with same CATH homology
 3AY5 A;  2JSW A;  1R0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...