The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
194
|
structure length |
194
|
Chain Sequence |
DVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural definition of the F-actin-binding THATCH domain from HIP1R
pubmed doi rcsb |
| molecule tags |
Structural protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Huntingtin Interacting Protein 12
|
| total genus |
80
|
| structure length |
194
|
| sequence length |
194
|
| chains with identical sequence |
B, D, E, F, G, H, I
|
| ec nomenclature | |
| pdb deposition date | 2003-09-19 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | I/LWEQ domain | I/LWEQ domain |
#chains in the Genus database with same CATH superfamily 1R0D A; 2JSW A; 3AY5 A; #chains in the Genus database with same CATH topology 1R0D A; 2JSW A; 3AY5 A; #chains in the Genus database with same CATH homology 1R0D A; 2JSW A; 3AY5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
