1RB8F

The phix174 dna binding protein j in two different capsid environments.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
422
structure length
422
Chain Sequence
REIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLAIDSKVDFFTFYIPHRHVYGDQWIQFMRDGVNAQPLPSVTCNRYPDHAGYVGTIVPANNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARYGFRCCHLKNIWSAPLPPETKLAEEMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMHTDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEHHYLAGKSQLTYTDLAGDPALIGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYVNFKYHDLHGFPFLDDAPGTSTGDNLQEAILVRHQDYDACFQSQQLLQWNKQARYNVSVYRHMPTVRDSIMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The phiX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells.
pubmed doi rcsb
molecule tags Virus/dna
source organism Enterobacteria phage phix174
molecule keywords Capsid protein
total genus 103
structure length 422
sequence length 422
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02305 Phage_F Capsid protein (F protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.169.10 Mainly Beta Sandwich Bacteriophage G4 Capsid Proteins Gpf, Gpg, Gpj, subunit 1 Microviridae F protein 1rb8F00
1AL0F 1GFF1 2BPA1 1RB8F 1CD3F 1M06F
chains in the Genus database with same CATH superfamily
1AL0F 1GFF1 2BPA1 1RB8F 1CD3F 1M06F
chains in the Genus database with same CATH topology
1AL0F 1GFF1 2BPA1 1RB8F 1CD3F 1M06F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AL0 F;  1GFF 1;  2BPA 1;  1RB8 F;  1CD3 F;  1M06 F; 
#chains in the Genus database with same CATH topology
 1AL0 F;  1GFF 1;  2BPA 1;  1RB8 F;  1CD3 F;  1M06 F; 
#chains in the Genus database with same CATH homology
 1AL0 F;  1GFF 1;  2BPA 1;  1RB8 F;  1CD3 F;  1M06 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...