The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
96
|
structure length |
96
|
Chain Sequence |
GSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Discovery and cocrystal structure of benzodiazepinedione HDM2 antagonists that activate p53 in cells
pubmed doi rcsb |
| molecule keywords |
Ubiquitin-protein ligase E3 Mdm2
|
| molecule tags |
Ligase
|
| source organism |
Homo sapiens
|
| total genus |
32
|
| structure length |
96
|
| sequence length |
96
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
| pdb deposition date | 2004-04-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02201 | SWIB | SWIB/MDM2 domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | MDM2 | SWIB/MDM2 domain |
#chains in the Genus database with same CATH superfamily 4LWT A; 4ZYF A; 1RV1 A; 4UD7 A; 4ODE A; 4OAS A; 2LZG A; 3JZO A; 3IWY A; 3VZV A; 1YCQ A; 3LNJ A; 3G03 A; 3TU1 A; 1Z1M A; 4ERE A; 1V31 A; 2GV2 A; 4N5T A; 2MPS A; 2Z5T M; 2AXI A; 2VYR A; 1UHR A; 3FEA A; 4JVR A; 3W69 A; 4RXZ A; 4ERF A; 4HG7 A; 3LNZ A; 4IPF A; 5HMK A; 4OCC A; 4UE1 A; 3LBJ E; 3TJ2 A; 4MDQ A; 3JZS A; 4JV7 A; 2Z5S M; 2MWY A; 3EQS A; 4JV9 A; 3EQY A; 4HBM A; 4UMN A; 2RUH A; 4OGT A; 4JWR A; 5LAW A; 5LAV A; 3DAC A; 5C5A A; 3FE7 A; 3IUX A; 5TRF A; 4OBA A; 3FDO A; 2N0W A; 1YCR A; 5HMH A; 3TPX A; 4QOC A; 4OQ3 A; 3JZK A; 4J7E A; 4ODF A; 4OGV A; 4J3E A; 3LBK A; 2N14 A; 5LAY A; 4HFZ A; 3VBG A; 4MDN A; 4ZFI A; 4LWU A; 3JZP A; 2N06 A; 4JRG A; 5AFG A; 4DIJ A; 1T4F M; 1TTV A; 4ZYC A; 4J74 A; 4ZGK A; 1V32 A; 4ZYI A; 1T4E A; 4OGN A; 3U15 A; 5HMI A; 3V3B A; 4LWV A; 5LN2 A; 4J7D A; 3DAB A; 3JZQ A; 3LBL A; 5LAZ A; 2M86 B; 2N0U A; 3JZR A; 4JVE A; 4QO4 A; 4JSC A; 4WT2 A; #chains in the Genus database with same CATH topology 4LWT A; 4ZYF A; 1RV1 A; 4UD7 A; 4ODE A; 4OAS A; 2LZG A; 3JZO A; 3IWY A; 3VZV A; 1YCQ A; 3LNJ A; 3G03 A; 3TU1 A; 1Z1M A; 4ERE A; 1V31 A; 2GV2 A; 4N5T A; 2MPS A; 2Z5T M; 2AXI A; 2VYR A; 1UHR A; 3FEA A; 4JVR A; 3W69 A; 4RXZ A; 4ERF A; 4HG7 A; 3LNZ A; 4IPF A; 5HMK A; 4OCC A; 4UE1 A; 3LBJ E; 3TJ2 A; 4MDQ A; 3JZS A; 4JV7 A; 2Z5S M; 2MWY A; 3EQS A; 4JV9 A; 3EQY A; 4HBM A; 4UMN A; 2RUH A; 4OGT A; 4JWR A; 5LAW A; 5LAV A; 3DAC A; 5C5A A; 3FE7 A; 3IUX A; 5TRF A; 4OBA A; 3FDO A; 2N0W A; 1YCR A; 5HMH A; 3TPX A; 4QOC A; 4OQ3 A; 3JZK A; 4J7E A; 4ODF A; 4OGV A; 4J3E A; 3LBK A; 2N14 A; 5LAY A; 4HFZ A; 3VBG A; 4MDN A; 4ZFI A; 4LWU A; 3JZP A; 2N06 A; 4JRG A; 5AFG A; 4DIJ A; 1T4F M; 1TTV A; 4ZYC A; 4J74 A; 4ZGK A; 1V32 A; 4ZYI A; 1T4E A; 4OGN A; 3U15 A; 5HMI A; 3V3B A; 4LWV A; 5LN2 A; 4J7D A; 3DAB A; 3JZQ A; 3LBL A; 5LAZ A; 2M86 B; 2N0U A; 3JZR A; 4JVE A; 4QO4 A; 4JSC A; 4WT2 A; #chains in the Genus database with same CATH homology 4LWT A; 4ZYF A; 1RV1 A; 4UD7 A; 4ODE A; 4OAS A; 2LZG A; 3JZO A; 3IWY A; 3VZV A; 1YCQ A; 3LNJ A; 3G03 A; 3TU1 A; 1Z1M A; 4ERE A; 1V31 A; 2GV2 A; 4N5T A; 2MPS A; 2Z5T M; 2AXI A; 2VYR A; 1UHR A; 3FEA A; 4JVR A; 3W69 A; 4RXZ A; 4ERF A; 4HG7 A; 3LNZ A; 4IPF A; 5HMK A; 4OCC A; 4UE1 A; 3LBJ E; 3TJ2 A; 4MDQ A; 3JZS A; 4JV7 A; 2Z5S M; 2MWY A; 3EQS A; 4JV9 A; 3EQY A; 4HBM A; 4UMN A; 2RUH A; 4OGT A; 4JWR A; 5LAW A; 5LAV A; 3DAC A; 5C5A A; 3FE7 A; 3IUX A; 5TRF A; 4OBA A; 3FDO A; 2N0W A; 1YCR A; 5HMH A; 3TPX A; 4QOC A; 4OQ3 A; 3JZK A; 4J7E A; 4ODF A; 4OGV A; 4J3E A; 3LBK A; 2N14 A; 5LAY A; 4HFZ A; 3VBG A; 4MDN A; 4ZFI A; 4LWU A; 3JZP A; 2N06 A; 4JRG A; 5AFG A; 4DIJ A; 1T4F M; 1TTV A; 4ZYC A; 4J74 A; 4ZGK A; 1V32 A; 4ZYI A; 1T4E A; 4OGN A; 3U15 A; 5HMI A; 3V3B A; 4LWV A; 5LN2 A; 4J7D A; 3DAB A; 3JZQ A; 3LBL A; 5LAZ A; 2M86 B; 2N0U A; 3JZR A; 4JVE A; 4QO4 A; 4JSC A; 4WT2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...