The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
190
|
structure length |
190
|
Chain Sequence |
FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISHLQSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTRDTCGANFIF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of RNase MC1 from bitter gourd seeds in complex with 5'UMP
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
Ribonuclease MC
|
total genus |
57
|
structure length |
190
|
sequence length |
190
|
ec nomenclature |
ec
3.1.27.1: Transferred entry: 4.6.1.19. |
pdb deposition date | 2003-04-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00445 | Ribonuclease_T2 | Ribonuclease T2 family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Ribonuclease Rh; Chain A | Ribonuclease T2-like |
#chains in the Genus database with same CATH superfamily 2PQY A; 1VD1 A; 4DVK A; 1V9H A; 1UCA A; 1UCD A; 1VCZ A; 4DWC A; 1SGL A; 3TBJ A; 1UCC A; 4DWA A; 1BOL A; 4DVL A; 2EA1 A; 1J1F A; 4DW4 A; 2PQX A; 1IYB A; 4DVN A; 3T0O A; 1IOO A; 1UCG A; 1BK7 A; 1J1G A; 2Z70 A; 4DW3 A; 1IQQ A; 1JY5 A; 1DIX A; 1VD3 A; 3D3Z A; 4DW7 A; 4DW5 A; #chains in the Genus database with same CATH topology 2PQY A; 1VD1 A; 4DVK A; 1V9H A; 1UCA A; 1UCD A; 1VCZ A; 4DWC A; 1SGL A; 3TBJ A; 1UCC A; 4DWA A; 1BOL A; 4DVL A; 2EA1 A; 1J1F A; 4DW4 A; 2PQX A; 1IYB A; 4DVN A; 3T0O A; 1IOO A; 1UCG A; 1BK7 A; 1J1G A; 2Z70 A; 4DW3 A; 1IQQ A; 1JY5 A; 1DIX A; 1VD3 A; 3D3Z A; 4DW7 A; 4DW5 A; #chains in the Genus database with same CATH homology 2PQY A; 1VD1 A; 4DVK A; 1V9H A; 1UCA A; 1UCD A; 1VCZ A; 4DWC A; 1SGL A; 3TBJ A; 1UCC A; 4DWA A; 1BOL A; 4DVL A; 2EA1 A; 1J1F A; 4DW4 A; 2PQX A; 1IYB A; 4DVN A; 3T0O A; 1IOO A; 1UCG A; 1BK7 A; 1J1G A; 2Z70 A; 4DW3 A; 1IQQ A; 1JY5 A; 1DIX A; 1VD3 A; 3D3Z A; 4DW7 A; 4DW5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...