The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
51
|
structure length |
51
|
Chain Sequence |
IEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQKGGTD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb |
molecule tags |
Protein transport
|
source organism |
Mus musculus
|
molecule keywords |
Ras-related protein Rab-22A
|
total genus |
19
|
structure length |
51
|
sequence length |
51
|
ec nomenclature | |
pdb deposition date | 2005-03-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF11464 | Rbsn | Rabenosyn Rab binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | DNA Excision Repair, Uvrb; Chain A | Rabenosyn, Rab binding domain |
#chains in the Genus database with same CATH superfamily 1Z0K B; 3V1F A; 1YZM A; 3V1E A; 3V1A A; 1Z0J B; 3V1B A; 3DKQ A; 3V1D A; 3V1C A; #chains in the Genus database with same CATH topology 1Z0K B; 3V1F A; 1YSM A; 1YZM A; 2LF0 A; 3V1E A; 2A26 A; 1Z0J B; 3V1A A; 3V1B A; 1E52 A; 1QOJ A; 3DKQ A; 3V1D A; 3V1C A; 4U1C A; 3PXG A; #chains in the Genus database with same CATH homology 1Z0K B; 3V1F A; 1YZM A; 3V1E A; 3V1A A; 1Z0J B; 3V1B A; 3DKQ A; 3V1D A; 3V1C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...