2LF0A

Solution structure of sf3636, a two-domain unknown function protein from shigella flexneri 2a, determined by joint refinement of nmr, residual dipolar couplings and small-angle x-ray scattering, nesg target sfr339/ocsp target sf3636
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'MKEVEKNEIKRLSDRLDAIRHQQADLSLVEAADKYAELEKEKATLEAEIARLREVHSQKLSKEAQKLMKMPFQRAITKKEQADMGKLKKSVRGLVVVHPMTALGREMGLEEMTGFSKTTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yibL
molecule tags Structural genomics, unknown function
source organism Shigella flexneri
publication title Solution structure of sf3636, a two-domain unknown function protein from Shigella flexneri 2a, determined by joint refinement of NMR, residual dipolar couplings and small-angle X-ray scattering
rcsb
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2011-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.150 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2lf0A02
4.10.860.10 Few Secondary Structures Irregular DNA Excision Repair, Uvrb; Chain A UVR domain 2lf0A01
4U1CA 1E52A 2A26A 2LF0A 1YSMA 3PXGA 1QOJA
chains in the Genus database with same CATH superfamily
1V9NA 2UU9H 1WVNA 2ZQEA 1DT4A 3UOEA 2Y3MA 4JI7H 3GABA 2DGRA 1VBIA 1SEIA 1YZMA 4JI0H 1IBKH 1X9ZA 2NN6G 4JI2H 1N32H 2A26A 4LFBH 4BA1I 2E3UA 4DV6H 4NBQA 1HNWH 3T1YH 3OETA 4DUYH 1ZZJA 4NZTM 1ZZKA 4DV2H 2PY9A 1IBLH 4DR7H 3RF2A 4DR6H 4B3MH 4GKKH 2BA0A 4LF7H 2O4CA 1WE8A 4OCHA 5JEAG 5LMNH 3GKUA 5LMUH 1N36H 2UUCH 4WANA 3V1AA 2FFMA 2VQFH 1J5EH 1I94H 3DKQA 3OSSD 4QMFB 2UUBH 3VKEA 1HNZH 4EC5A 1AN7A 4DV7H 1MSZA 1VIGA 2M8WA 3I0PA 2P2RA 2K1HA 2YQRA 2AXYA 2LRRA 1DTJA 4AIMA 4B8CD 1QOJA 1Z2IA 3V1EA 1HNXH 2CTLA 4PDBA 5BR8H 2JA9A 5LL6b 1ODHA 3AEVB 4DR2H 1X4MA 3SB1A 2LF0A 4DR3H 1J5KA 2CTJA 2HHHH 3NCVA 1Z0KB 1FKAH 4BA2I 4E9JA 2JZXA 3L7ZC 5IWAH 2ZM6H 2G8YA 1X4NA 2JEBI 2MJHA 4JI4H 3EZJA 1WTJA 4GKJH 4B3RH 2CPMA 2FMRA 4JI5H 2OPUA 4DV1H 2ANNA 3U1KA 3J7AK 4LIJA 1S03G 1UG8A 2PQUA 2CTFA 3QD7X 4LF8H 4OX9H 1XNRH 4JYAH 1TUAA 4X62H 1EC6A 4FJUA 2UXBH 2VKCA 4DR4H 4DV5H 2FPHX 2LTLA 1S20A 4G08A 4AM3A 1XMOH 1I6UA 2UUAH 4WALA 4JI6H 2ANRA 2JEAI 3KDKA 3V1CA 4LFCH 4YHHH 2CTEA 3FAUA 4DR5H 2X06A 2BL5A 5A2QW 4LF6H 3V1DA 5C0XG 4NXMH 1IBMH 2E5LH 4NZRM 1XNQH 5K36G 4B3SH 4JI3H 1F0XA 2UXDH 2VQEH 2LTMA 4B3TH 4DR1H 2JVZA 3GR5A 4JV5H 4OD6A 4X65H 5DT9A 4DV3H 4DV4H 4DUZH 4LF4H 3JAMW 4KHPH 1ZZIA 2CWFA 2HH3A 4H8AA 3T1HH 4JI8H 2M6QA 2A1SA 2CTKA 3V1FA 2JE6I 4JVHA 1NXUA 2QNDA 2CWHA 3J80W 2OPVA 4YY3H 4AQYH 2CTMA 1E52A 1WHRA 1XRHA 4IFDG 4OO1G 1KHMA 5FLXW 4K0KH 1YSMA 3V1BA 4DV0H 1N33H 1VIHA 2HH2A 2D9IA 4X66H 1J4WA 4JI1H 1K1GA 4LFAH 2F4VH 3J81W 1V8CA 2CPQA 3KDGA 4B8TA 1XMQH 4NXNH 5IT9W 1ZTGA 3OTOH 4LF5H 2UXCH 4FJSA 1X0AA 1Z0JB 4X64H 1PQXA 4LF9H 1FJGH 4U1CA 1N34H 2Z0SA 1HR0H 3PXGA 3V69A 2PT7G 4JVYA
chains in the Genus database with same CATH topology
2UU9H 2ZQEA 2Y3MA 4JI7H 3GABA 1SEIA 4JI0H 1IBKH 1X9ZA 4JI2H 1N32H 2A26A 4LFBH 4DV6H 1HNWH 3T1YH 3OETA 4DUYH 4NZTM 4DV2H 4DR7H 1IBLH 3RF2A 4DR6H 4B3MH 4GKKH 4LF7H 2O4CA 4OCHA 5LMNH 5LMUH 1N36H 2UUCH 1J5EH 2VQFH 1I94H 3OSSD 2UUBH 1HNZH 4EC5A 1AN7A 4DV7H 4B8CD 1QOJA 1HNXH 4PDBA 5BR8H 5LL6b 1ODHA 4DR2H 3SB1A 4DR3H 2LF0A 2HHHH 3NCVA 1FKAH 4E9JA 5IWAH 2ZM6H 4JI4H 3EZJA 4GKJH 4B3RH 4JI5H 4DV1H 3J7AK 1S03G 4LF8H 1XNRH 4OX9H 3QD7X 4JYAH 4X62H 2UXBH 2VKCA 4DR4H 4DV5H 2FPHX 4G08A 1I6UA 1XMOH 2UUAH 4JI6H 3KDKA 4LFCH 4YHHH 3FAUA 4DR5H 5A2QW 4LF6H 4NXMH 1IBMH 2E5LH 4NZRM 1XNQH 4B3SH 4JI3H 1F0XA 2UXDH 2VQEH 4B3TH 4DR1H 3GR5A 4JV5H 4OD6A 4X65H 5DT9A 4DV3H 4DV4H 4DUZH 4LF4H 3JAMW 4KHPH 3T1HH 4JI8H 3J80W 4YY3H 4AQYH 1E52A 5FLXW 4K0KH 1YSMA 4DV0H 1N33H 2D9IA 4X66H 4JI1H 4LFAH 2F4VH 3J81W 1XMQH 3KDGA 4NXNH 5IT9W 3OTOH 4LF5H 2UXCH 4X64H 4U1CA 4LF9H 1FJGH 1N34H 1HR0H 3PXGA 2PT7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1C A;  1E52 A;  2A26 A;  2LF0 A;  1YSM A;  3PXG A;  1QOJ A; 
#chains in the Genus database with same CATH topology
 1V9N A;  2UU9 H;  1WVN A;  2ZQE A;  1DT4 A;  3UOE A;  2Y3M A;  4JI7 H;  3GAB A;  2DGR A;  1VBI A;  1SEI A;  1YZM A;  4JI0 H;  1IBK H;  1X9Z A;  2NN6 G;  4JI2 H;  1N32 H;  2A26 A;  4LFB H;  4BA1 I;  2E3U A;  4DV6 H;  4NBQ A;  1HNW H;  3T1Y H;  3OET A;  4DUY H;  1ZZJ A;  4NZT M;  1ZZK A;  4DV2 H;  2PY9 A;  1IBL H;  4DR7 H;  3RF2 A;  4DR6 H;  4B3M H;  4GKK H;  2BA0 A;  4LF7 H;  2O4C A;  1WE8 A;  4OCH A;  5JEA G;  5LMN H;  3GKU A;  5LMU H;  1N36 H;  2UUC H;  4WAN A;  3V1A A;  2FFM A;  2VQF H;  1J5E H;  1I94 H;  3DKQ A;  3OSS D;  4QMF B;  2UUB H;  3VKE A;  1HNZ H;  4EC5 A;  1AN7 A;  4DV7 H;  1MSZ A;  1VIG A;  2M8W A;  3I0P A;  2P2R A;  2K1H A;  2YQR A;  2AXY A;  2LRR A;  1DTJ A;  4AIM A;  4B8C D;  1QOJ A;  1Z2I A;  3V1E A;  1HNX H;  2CTL A;  4PDB A;  5BR8 H;  2JA9 A;  5LL6 b;  1ODH A;  3AEV B;  4DR2 H;  1X4M A;  3SB1 A;  2LF0 A;  4DR3 H;  1J5K A;  2CTJ A;  2HHH H;  3NCV A;  1Z0K B;  1FKA H;  4BA2 I;  4E9J A;  2JZX A;  3L7Z C;  5IWA H;  2ZM6 H;  2G8Y A;  1X4N A;  2JEB I;  2MJH A;  4JI4 H;  3EZJ A;  1WTJ A;  4GKJ H;  4B3R H;  2CPM A;  2FMR A;  4JI5 H;  2OPU A;  4DV1 H;  2ANN A;  3U1K A;  3J7A K;  4LIJ A;  1S03 G;  1UG8 A;  2PQU A;  2CTF A;  3QD7 X;  4LF8 H;  4OX9 H;  1XNR H;  4JYA H;  1TUA A;  4X62 H;  1EC6 A;  4FJU A;  2UXB H;  2VKC A;  4DR4 H;  4DV5 H;  2FPH X;  2LTL A;  1S20 A;  4G08 A;  4AM3 A;  1XMO H;  1I6U A;  2UUA H;  4WAL A;  4JI6 H;  2ANR A;  2JEA I;  3KDK A;  3V1C A;  4LFC H;  4YHH H;  2CTE A;  3FAU A;  4DR5 H;  2X06 A;  2BL5 A;  5A2Q W;  4LF6 H;  3V1D A;  5C0X G;  4NXM H;  1IBM H;  2E5L H;  4NZR M;  1XNQ H;  5K36 G;  4B3S H;  4JI3 H;  1F0X A;  2UXD H;  2VQE H;  2LTM A;  4B3T H;  4DR1 H;  2JVZ A;  3GR5 A;  4JV5 H;  4OD6 A;  4X65 H;  5DT9 A;  4DV3 H;  4DV4 H;  4DUZ H;  4LF4 H;  3JAM W;  4KHP H;  1ZZI A;  2CWF A;  2HH3 A;  4H8A A;  3T1H H;  4JI8 H;  2M6Q A;  2A1S A;  2CTK A;  3V1F A;  2JE6 I;  4JVH A;  1NXU A;  2QND A;  2CWH A;  3J80 W;  2OPV A;  4YY3 H;  4AQY H;  2CTM A;  1E52 A;  1WHR A;  1XRH A;  4IFD G;  4OO1 G;  1KHM A;  5FLX W;  4K0K H;  1YSM A;  3V1B A;  4DV0 H;  1N33 H;  1VIH A;  2HH2 A;  2D9I A;  4X66 H;  1J4W A;  4JI1 H;  1K1G A;  4LFA H;  2F4V H;  3J81 W;  1V8C A;  2CPQ A;  3KDG A;  4B8T A;  1XMQ H;  4NXN H;  5IT9 W;  1ZTG A;  3OTO H;  4LF5 H;  2UXC H;  4FJS A;  1X0A A;  1Z0J B;  4X64 H;  1PQX A;  4LF9 H;  1FJG H;  4U1C A;  1N34 H;  2Z0S A;  1HR0 H;  3PXG A;  3V69 A;  2PT7 G;  4JVY A; 
#chains in the Genus database with same CATH homology
 2UU9 H;  2ZQE A;  2Y3M A;  4JI7 H;  3GAB A;  1SEI A;  4JI0 H;  1IBK H;  1X9Z A;  4JI2 H;  1N32 H;  2A26 A;  4LFB H;  4DV6 H;  1HNW H;  3T1Y H;  3OET A;  4DUY H;  4NZT M;  4DV2 H;  4DR7 H;  1IBL H;  3RF2 A;  4DR6 H;  4B3M H;  4GKK H;  4LF7 H;  2O4C A;  4OCH A;  5LMN H;  5LMU H;  1N36 H;  2UUC H;  1J5E H;  2VQF H;  1I94 H;  3OSS D;  2UUB H;  1HNZ H;  4EC5 A;  1AN7 A;  4DV7 H;  4B8C D;  1QOJ A;  1HNX H;  4PDB A;  5BR8 H;  5LL6 b;  1ODH A;  4DR2 H;  3SB1 A;  4DR3 H;  2LF0 A;  2HHH H;  3NCV A;  1FKA H;  4E9J A;  5IWA H;  2ZM6 H;  4JI4 H;  3EZJ A;  4GKJ H;  4B3R H;  4JI5 H;  4DV1 H;  3J7A K;  1S03 G;  4LF8 H;  1XNR H;  4OX9 H;  3QD7 X;  4JYA H;  4X62 H;  2UXB H;  2VKC A;  4DR4 H;  4DV5 H;  2FPH X;  4G08 A;  1I6U A;  1XMO H;  2UUA H;  4JI6 H;  3KDK A;  4LFC H;  4YHH H;  3FAU A;  4DR5 H;  5A2Q W;  4LF6 H;  4NXM H;  1IBM H;  2E5L H;  4NZR M;  1XNQ H;  4B3S H;  4JI3 H;  1F0X A;  2UXD H;  2VQE H;  4B3T H;  4DR1 H;  3GR5 A;  4JV5 H;  4OD6 A;  4X65 H;  5DT9 A;  4DV3 H;  4DV4 H;  4DUZ H;  4LF4 H;  3JAM W;  4KHP H;  3T1H H;  4JI8 H;  3J80 W;  4YY3 H;  4AQY H;  1E52 A;  5FLX W;  4K0K H;  1YSM A;  4DV0 H;  1N33 H;  2D9I A;  4X66 H;  4JI1 H;  4LFA H;  2F4V H;  3J81 W;  1XMQ H;  3KDG A;  4NXN H;  5IT9 W;  3OTO H;  4LF5 H;  2UXC H;  4X64 H;  4U1C A;  4LF9 H;  1FJG H;  1N34 H;  1HR0 H;  3PXG A;  2PT7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...