2LF0A

Solution structure of sf3636, a two-domain unknown function protein from shigella flexneri 2a, determined by joint refinement of nmr, residual dipolar couplings and small-angle x-ray scattering, nesg target sfr339/ocsp target sf3636
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
MKEVEKNEIKRLSDRLDAIRHQQADLSLVEAADKYAELEKEKATLEAEIARLREVHSQKLSKEAQKLMKMPFQRAITKKEQADMGKLKKSVRGLVVVHPMTALGREMGLEEMTGFSKTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein yibL
publication title Solution structure of sf3636, a two-domain unknown function protein from Shigella flexneri 2a, determined by joint refinement of NMR, residual dipolar couplings and small-angle X-ray scattering
rcsb
source organism Shigella flexneri
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2011-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.150 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2lf0A02
4.10.860.10 Few Secondary Structures Irregular DNA Excision Repair, Uvrb; Chain A UVR domain 2lf0A01
3PXGA 2LF0A 2A26A 1YSMA 1E52A 1QOJA 4U1CA
chains in the Genus database with same CATH superfamily
4GKJH 1WTJA 4JI7H 1ZZIA 1IBMH 4JI6H 1I6UA 1J5EH 2PY9A 4JV5H 4JI8H 1X4MA 3V1BA 5IT9W 1PQXA 2CWHA 4AM3A 2LF0A 4DR5H 3J81W 1ZZKA 2PT7G 4DV2H 1HNWH 1YSMA 1ZZJA 2UUAH 2LTMA 4DR1H 2CTFA 3DKQA 4JI4H 4OO1G 3V1EA 1J4WA 3U1KA 4DR4H 3OETA 2CWFA 4IFDG 5IWAH 3RF2A 1XNQH 1WHRA 4DR7H 5FLXW 2UXDH 1ODHA 2CPMA 2M8WA 4OD6A 4LF8H 4DUZH 4OX9H 4NZRM 3V1FA 2X06A 4DV3H 4B8TA 2CTKA 4X65H 3T1HH 4LF5H 4NXMH 1VIGA 4LF4H 1S03G 4DV5H 4JYAH 4DR3H 3QD7X 2UXCH 1NXUA 2FFMA 1S20A 1XRHA 2NN6G 2VQEH 1E52A 1HR0H 4BA2I 2P2RA 4LF7H 2DGRA 2LRRA 4WALA 3GABA 1KHMA 4FJUA 2BL5A 3NCVA 2K1HA 4WANA 2YQRA 5A2QW 3VKEA 2M6QA 2OPUA 2MJHA 4YY3H 2PQUA 4GKKH 4AIMA 2BA0A 2JE6I 4H8AA 1WE8A 4JI1H 3SB1A 4LIJA 1K1GA 4LF6H 2A1SA 2ANRA 1ZTGA 2UXBH 2JZXA 4X64H 1VBIA 1HNZH 1AN7A 1DT4A 1TUAA 2CTMA 2CTEA 4DR2H 1N32H 4DV0H 4NZTM 1Z0JB 4DV7H 2VKCA 4DUYH 5LMNH 4PDBA 2E5LH 5LMUH 1N36H 1HNXH 2QNDA 5C0XG 2F4VH 1EC6A 3GR5A 3GKUA 3OTOH 1F0XA 1MSZA 4JVHA 4G08A 3EZJA 2HHHH 1VIHA 2HH2A 2JVZA 1FJGH 1UG8A 4DV6H 4K0KH 2O4CA 3L7ZC 2JEBI 4B8CD 4LFBH 1YZMA 4DV1H 1IBLH 1Z0KB 4DV4H 2JA9A 5LL6b 3I0PA 5DT9A 5BR8H 4U1CA 4B3TH 1Z2IA 2Z0SA 3V1AA 4QMFB 1I94H 5JEAG 2E3UA 2OPVA 2G8YA 1X9ZA 3KDKA 3V1CA 3KDGA 3J80W 1XMOH 2CTJA 4JI5H 2Y3MA 1V9NA 4B3RH 5K36G 4JI3H 4JVYA 2UU9H 1QOJA 3T1YH 4JI2H 4B3MH 3JAMW 4B3SH 4LFCH 3PXGA 2UUBH 4AQYH 1FKAH 4LF9H 2AXYA 4NXNH 2FMRA 4BA1I 2CPQA 1SEIA 2FPHX 3FAUA 3V69A 4YHHH 2ZM6H 1V8CA 1N34H 4JI0H 2D9IA 1XNRH 3V1DA 4X66H 2JEAI 2LTLA 2A26A 1WVNA 2ZQEA 2HH3A 4NBQA 2CTLA 3UOEA 2ANNA 1X4NA 3OSSD 1J5KA 1IBKH 4OCHA 4KHPH 1DTJA 4LFAH 4X62H 4EC5A 4E9JA 4FJSA 2VQFH 4DR6H 1XMQH 1N33H 1X0AA 3J7AK 3AEVB 2UUCH
chains in the Genus database with same CATH topology
4GKJH 4JI7H 1IBMH 4JI6H 1I6UA 1J5EH 4JV5H 4JI8H 5IT9W 2LF0A 4DR5H 3J81W 1YSMA 2PT7G 4DV2H 1HNWH 2UUAH 4DR1H 4JI4H 4DR4H 3OETA 5IWAH 3RF2A 1XNQH 4DR7H 5FLXW 2UXDH 1ODHA 4LF8H 4OD6A 4DUZH 4OX9H 4NZRM 4DV3H 4LF5H 3T1HH 4X65H 4NXMH 1S03G 4LF4H 4DV5H 4JYAH 4DR3H 3QD7X 2UXCH 1E52A 2VQEH 1HR0H 4LF7H 3GABA 3NCVA 5A2QW 4YY3H 4GKKH 4JI1H 3SB1A 4LF6H 2UXBH 4X64H 1HNZH 1AN7A 4DR2H 1N32H 4DV0H 4NZTM 4DV7H 2VKCA 4DUYH 5LMNH 4PDBA 2E5LH 5LMUH 1N36H 1HNXH 2F4VH 3GR5A 3OTOH 1F0XA 4G08A 3EZJA 2HHHH 1FJGH 4DV6H 4K0KH 2O4CA 4B8CD 4LFBH 4DV1H 1IBLH 4DV4H 5LL6b 5DT9A 5BR8H 4U1CA 4B3TH 1I94H 1X9ZA 3KDKA 3KDGA 1XMOH 3J80W 4JI5H 2Y3MA 4B3RH 4JI3H 2UU9H 3T1YH 4JI2H 4B3MH 3JAMW 4B3SH 4LFCH 3PXGA 2UUBH 4AQYH 1FKAH 4LF9H 4NXNH 2FPHX 1SEIA 3FAUA 4YHHH 2ZM6H 1N34H 4JI0H 2D9IA 1XNRH 4X66H 2A26A 2ZQEA 3OSSD 1IBKH 4OCHA 4KHPH 4LFAH 4X62H 4EC5A 4E9JA 4DR6H 2VQFH 1XMQH 1N33H 1QOJA 3J7AK 2UUCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXG A;  2LF0 A;  2A26 A;  1YSM A;  1E52 A;  1QOJ A;  4U1C A; 
#chains in the Genus database with same CATH topology
 4GKJ H;  1WTJ A;  4JI7 H;  1ZZI A;  1IBM H;  4JI6 H;  1I6U A;  1J5E H;  2PY9 A;  4JV5 H;  4JI8 H;  1X4M A;  3V1B A;  5IT9 W;  1PQX A;  2CWH A;  4AM3 A;  2LF0 A;  4DR5 H;  3J81 W;  1ZZK A;  2PT7 G;  4DV2 H;  1HNW H;  1YSM A;  1ZZJ A;  2UUA H;  2LTM A;  4DR1 H;  2CTF A;  3DKQ A;  4JI4 H;  4OO1 G;  3V1E A;  1J4W A;  3U1K A;  4DR4 H;  3OET A;  2CWF A;  4IFD G;  5IWA H;  3RF2 A;  1XNQ H;  1WHR A;  4DR7 H;  5FLX W;  2UXD H;  1ODH A;  2CPM A;  2M8W A;  4OD6 A;  4LF8 H;  4DUZ H;  4OX9 H;  4NZR M;  3V1F A;  2X06 A;  4DV3 H;  4B8T A;  2CTK A;  4X65 H;  3T1H H;  4LF5 H;  4NXM H;  1VIG A;  4LF4 H;  1S03 G;  4DV5 H;  4JYA H;  4DR3 H;  3QD7 X;  2UXC H;  1NXU A;  2FFM A;  1S20 A;  1XRH A;  2NN6 G;  2VQE H;  1E52 A;  1HR0 H;  4BA2 I;  2P2R A;  4LF7 H;  2DGR A;  2LRR A;  4WAL A;  3GAB A;  1KHM A;  4FJU A;  2BL5 A;  3NCV A;  2K1H A;  4WAN A;  2YQR A;  5A2Q W;  3VKE A;  2M6Q A;  2OPU A;  2MJH A;  4YY3 H;  2PQU A;  4GKK H;  4AIM A;  2BA0 A;  2JE6 I;  4H8A A;  1WE8 A;  4JI1 H;  3SB1 A;  4LIJ A;  1K1G A;  4LF6 H;  2A1S A;  2ANR A;  1ZTG A;  2UXB H;  2JZX A;  4X64 H;  1VBI A;  1HNZ H;  1AN7 A;  1DT4 A;  1TUA A;  2CTM A;  2CTE A;  4DR2 H;  1N32 H;  4DV0 H;  4NZT M;  1Z0J B;  4DV7 H;  2VKC A;  4DUY H;  5LMN H;  4PDB A;  2E5L H;  5LMU H;  1N36 H;  1HNX H;  2QND A;  5C0X G;  2F4V H;  1EC6 A;  3GR5 A;  3GKU A;  3OTO H;  1F0X A;  1MSZ A;  4JVH A;  4G08 A;  3EZJ A;  2HHH H;  1VIH A;  2HH2 A;  2JVZ A;  1FJG H;  1UG8 A;  4DV6 H;  4K0K H;  2O4C A;  3L7Z C;  2JEB I;  4B8C D;  4LFB H;  1YZM A;  4DV1 H;  1IBL H;  1Z0K B;  4DV4 H;  2JA9 A;  5LL6 b;  3I0P A;  5DT9 A;  5BR8 H;  4U1C A;  4B3T H;  1Z2I A;  2Z0S A;  3V1A A;  4QMF B;  1I94 H;  5JEA G;  2E3U A;  2OPV A;  2G8Y A;  1X9Z A;  3KDK A;  3V1C A;  3KDG A;  3J80 W;  1XMO H;  2CTJ A;  4JI5 H;  2Y3M A;  1V9N A;  4B3R H;  5K36 G;  4JI3 H;  4JVY A;  2UU9 H;  1QOJ A;  3T1Y H;  4JI2 H;  4B3M H;  3JAM W;  4B3S H;  4LFC H;  3PXG A;  2UUB H;  4AQY H;  1FKA H;  4LF9 H;  2AXY A;  4NXN H;  2FMR A;  4BA1 I;  2CPQ A;  1SEI A;  2FPH X;  3FAU A;  3V69 A;  4YHH H;  2ZM6 H;  1V8C A;  1N34 H;  4JI0 H;  2D9I A;  1XNR H;  3V1D A;  4X66 H;  2JEA I;  2LTL A;  2A26 A;  1WVN A;  2ZQE A;  2HH3 A;  4NBQ A;  2CTL A;  3UOE A;  2ANN A;  1X4N A;  3OSS D;  1J5K A;  1IBK H;  4OCH A;  4KHP H;  1DTJ A;  4LFA H;  4X62 H;  4EC5 A;  4E9J A;  4FJS A;  2VQF H;  4DR6 H;  1XMQ H;  1N33 H;  1X0A A;  3J7A K;  3AEV B;  2UUC H; 
#chains in the Genus database with same CATH homology
 4GKJ H;  4JI7 H;  1IBM H;  4JI6 H;  1I6U A;  1J5E H;  4JV5 H;  4JI8 H;  5IT9 W;  2LF0 A;  4DR5 H;  3J81 W;  1YSM A;  2PT7 G;  4DV2 H;  1HNW H;  2UUA H;  4DR1 H;  4JI4 H;  4DR4 H;  3OET A;  5IWA H;  3RF2 A;  1XNQ H;  4DR7 H;  5FLX W;  2UXD H;  1ODH A;  4LF8 H;  4OD6 A;  4DUZ H;  4OX9 H;  4NZR M;  4DV3 H;  4LF5 H;  3T1H H;  4X65 H;  4NXM H;  1S03 G;  4LF4 H;  4DV5 H;  4JYA H;  4DR3 H;  3QD7 X;  2UXC H;  1E52 A;  2VQE H;  1HR0 H;  4LF7 H;  3GAB A;  3NCV A;  5A2Q W;  4YY3 H;  4GKK H;  4JI1 H;  3SB1 A;  4LF6 H;  2UXB H;  4X64 H;  1HNZ H;  1AN7 A;  4DR2 H;  1N32 H;  4DV0 H;  4NZT M;  4DV7 H;  2VKC A;  4DUY H;  5LMN H;  4PDB A;  2E5L H;  5LMU H;  1N36 H;  1HNX H;  2F4V H;  3GR5 A;  3OTO H;  1F0X A;  4G08 A;  3EZJ A;  2HHH H;  1FJG H;  4DV6 H;  4K0K H;  2O4C A;  4B8C D;  4LFB H;  4DV1 H;  1IBL H;  4DV4 H;  5LL6 b;  5DT9 A;  5BR8 H;  4U1C A;  4B3T H;  1I94 H;  1X9Z A;  3KDK A;  3KDG A;  1XMO H;  3J80 W;  4JI5 H;  2Y3M A;  4B3R H;  4JI3 H;  2UU9 H;  3T1Y H;  4JI2 H;  4B3M H;  3JAM W;  4B3S H;  4LFC H;  3PXG A;  2UUB H;  4AQY H;  1FKA H;  4LF9 H;  4NXN H;  2FPH X;  1SEI A;  3FAU A;  4YHH H;  2ZM6 H;  1N34 H;  4JI0 H;  2D9I A;  1XNR H;  4X66 H;  2A26 A;  2ZQE A;  3OSS D;  1IBK H;  4OCH A;  4KHP H;  4LFA H;  4X62 H;  4EC5 A;  4E9J A;  4DR6 H;  2VQF H;  1XMQ H;  1N33 H;  1QOJ A;  3J7A K;  2UUC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...