2LF0A

Solution structure of sf3636, a two-domain unknown function protein from shigella flexneri 2a, determined by joint refinement of nmr, residual dipolar couplings and small-angle x-ray scattering, nesg target sfr339/ocsp target sf3636
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
MKEVEKNEIKRLSDRLDAIRHQQADLSLVEAADKYAELEKEKATLEAEIARLREVHSQKLSKEAQKLMKMPFQRAITKKEQADMGKLKKSVRGLVVVHPMTALGREMGLEEMTGFSKTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yibL
publication title Solution structure of sf3636, a two-domain unknown function protein from Shigella flexneri 2a, determined by joint refinement of NMR, residual dipolar couplings and small-angle X-ray scattering
rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
total genus 31
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2011-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.150 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2lf0A02
4.10.860.10 Few Secondary Structures Irregular DNA Excision Repair, Uvrb; Chain A UVR domain 2lf0A01
4U1CA 2LF0A 1YSMA 1QOJA 2A26A 3PXGA 1E52A
chains in the Genus database with same CATH superfamily
2E3UA 2HH2A 4JVYA 1ZZKA 1ZZIA 1EC6A 3KDGA 4LF7H 2CTMA 1WVNA 2LTMA 5FLXW 4DV1H 4LF6H 4BA1I 1N36H 2JVZA 3KDKA 1J5KA 1HR0H 3PXGA 3V1DA 4WALA 2FMRA 2VQEH 4JI8H 1VIHA 3V1CA 1I94H 2JEAI 4FJSA 1TUAA 2CTJA 4NZRM 3QD7X 2X06A 3GABA 2F4VH 2UUBH 3DKQA 1J5EH 1X4NA 2JA9A 4DV5H 4JI5H 4DV0H 1Z0JB 1N33H 2Y3MA 4E9JA 1XMQH 4H8AA 1V8CA 1HNXH 5K36G 2P2RA 1VBIA 2NN6G 4NBQA 2JZXA 2CPQA 3VKEA 2PQUA 1XRHA 1ODHA 2UU9H 2ANNA 2CPMA 2ZQEA 4EC5A 1J4WA 1I6UA 2Z0SA 3J80W 2JEBI 1Z2IA 3UOEA 5IT9W 2ZM6H 4IFDG 4G08A 2AXYA 2CTEA 2CWHA 4DR6H 3J7AK 3NCVA 1ZZJA 4JYAH 3FAUA 1FKAH 4AIMA 4GKKH 4JI0H 4LFAH 3I0PA 4DR1H 5LMUH 1KHMA 2CTFA 1S20A 5LL6b 4YHHH 1YSMA 4DR2H 3OTOH 1HNZH 4X65H 1UG8A 1YZMA 4K0KH 4LIJA 4JI3H 2D9IA 4NXMH 2FFMA 4B3SH 3EZJA 4DV3H 4OCHA 1SEIA 1WE8A 3AEVB 4JI7H 2A1SA 4JV5H 1VIGA 4AQYH 2K1HA 2VQFH 4DR5H 1K1GA 2HH3A 2LF0A 4JI1H 4DR7H 2BL5A 4X66H 1X9ZA 4LF8H 4B3RH 3GKUA 4DUYH 4U1CA 1F0XA 2CTKA 4LF5H 1XNQH 3L7ZC 1DT4A 1X4MA 3OSSD 3V69A 4OD6A 4KHPH 1IBLH 1N32H 1PQXA 3V1BA 3J81W 4B8CD 1V9NA 2M6QA 2O4CA 4QMFB 5IWAH 4NXNH 4LFBH 4FJUA 4OO1G 4B3TH 4PDBA 2JE6I 2UXDH 2DGRA 4JI6H 2PT7G 4JI4H 4AM3A 4LFCH 1E52A 2LTLA 2UXCH 2OPUA 3T1HH 2FPHX 2YQRA 4JI2H 5C0XG 2PY9A 4WANA 5BR8H 4DV4H 4NZTM 4LF4H 2BA0A 1HNWH 2HHHH 3V1AA 2G8YA 3V1EA 2E5LH 1QOJA 3T1YH 4B3MH 4DV7H 2QNDA 1WHRA 1Z0KB 4OX9H 1IBKH 4LF9H 4JVHA 2VKCA 2MJHA 3RF2A 4DV2H 1N34H 2ANRA 5A2QW 2UUAH 4BA2I 1AN7A 1XMOH 1ZTGA 4YY3H 1DTJA 1S03G 5JEAG 1X0AA 3U1KA 1NXUA 4X62H 5LMNH 1IBMH 2UXBH 4DV6H 4X64H 1MSZA 3GR5A 4GKJH 3OETA 3SB1A 3V1FA 2CTLA 4DR3H 2UUCH 1XNRH 4B8TA 2OPVA 2CWFA 1FJGH 4DR4H 2LRRA 1WTJA 5DT9A 2A26A 2M8WA 3JAMW 4DUZH
chains in the Genus database with same CATH topology
3KDGA 4LF7H 5FLXW 4DV1H 4LF6H 1N36H 3KDKA 1HR0H 3PXGA 2VQEH 4JI8H 1I94H 4NZRM 3QD7X 3GABA 2F4VH 2UUBH 1J5EH 4DV5H 4JI5H 4DV0H 1N33H 2Y3MA 4E9JA 1XMQH 1HNXH 1ODHA 2UU9H 2ZQEA 4EC5A 1I6UA 3J80W 5IT9W 2ZM6H 4G08A 4DR6H 3J7AK 3NCVA 4JYAH 3FAUA 1FKAH 4GKKH 4JI0H 4LFAH 4DR1H 5LMUH 5LL6b 4YHHH 1YSMA 4DR2H 3OTOH 1HNZH 4X65H 4K0KH 4JI3H 2D9IA 4NXMH 4B3SH 3EZJA 4DV3H 4OCHA 1SEIA 4JI7H 4JV5H 4AQYH 2VQFH 4DR5H 4JI1H 2LF0A 4DR7H 4X66H 1X9ZA 4LF8H 4B3RH 4DUYH 4U1CA 1F0XA 4LF5H 1XNQH 3OSSD 4OD6A 4KHPH 1IBLH 1N32H 3J81W 4B8CD 2O4CA 5IWAH 4LFBH 4NXNH 2UXDH 4B3TH 4PDBA 4JI6H 2PT7G 4JI4H 4LFCH 1E52A 2UXCH 3T1HH 2FPHX 4JI2H 5BR8H 4DV4H 4NZTM 4LF4H 1HNWH 2HHHH 2E5LH 1QOJA 3T1YH 4B3MH 4DV7H 4OX9H 1IBKH 4LF9H 2VKCA 3RF2A 4DV2H 1N34H 5A2QW 2UUAH 1AN7A 1XMOH 4YY3H 1S03G 4X62H 5LMNH 1IBMH 2UXBH 4DV6H 4X64H 4GKJH 3GR5A 3OETA 3SB1A 4DR3H 2UUCH 1XNRH 1FJGH 4DR4H 5DT9A 2A26A 3JAMW 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1C A;  2LF0 A;  1YSM A;  1QOJ A;  2A26 A;  3PXG A;  1E52 A; 
#chains in the Genus database with same CATH topology
 2E3U A;  2HH2 A;  4JVY A;  1ZZK A;  1ZZI A;  1EC6 A;  3KDG A;  4LF7 H;  2CTM A;  1WVN A;  2LTM A;  5FLX W;  4DV1 H;  4LF6 H;  4BA1 I;  1N36 H;  2JVZ A;  3KDK A;  1J5K A;  1HR0 H;  3PXG A;  3V1D A;  4WAL A;  2FMR A;  2VQE H;  4JI8 H;  1VIH A;  3V1C A;  1I94 H;  2JEA I;  4FJS A;  1TUA A;  2CTJ A;  4NZR M;  3QD7 X;  2X06 A;  3GAB A;  2F4V H;  2UUB H;  3DKQ A;  1J5E H;  1X4N A;  2JA9 A;  4DV5 H;  4JI5 H;  4DV0 H;  1Z0J B;  1N33 H;  2Y3M A;  4E9J A;  1XMQ H;  4H8A A;  1V8C A;  1HNX H;  5K36 G;  2P2R A;  1VBI A;  2NN6 G;  4NBQ A;  2JZX A;  2CPQ A;  3VKE A;  2PQU A;  1XRH A;  1ODH A;  2UU9 H;  2ANN A;  2CPM A;  2ZQE A;  4EC5 A;  1J4W A;  1I6U A;  2Z0S A;  3J80 W;  2JEB I;  1Z2I A;  3UOE A;  5IT9 W;  2ZM6 H;  4IFD G;  4G08 A;  2AXY A;  2CTE A;  2CWH A;  4DR6 H;  3J7A K;  3NCV A;  1ZZJ A;  4JYA H;  3FAU A;  1FKA H;  4AIM A;  4GKK H;  4JI0 H;  4LFA H;  3I0P A;  4DR1 H;  5LMU H;  1KHM A;  2CTF A;  1S20 A;  5LL6 b;  4YHH H;  1YSM A;  4DR2 H;  3OTO H;  1HNZ H;  4X65 H;  1UG8 A;  1YZM A;  4K0K H;  4LIJ A;  4JI3 H;  2D9I A;  4NXM H;  2FFM A;  4B3S H;  3EZJ A;  4DV3 H;  4OCH A;  1SEI A;  1WE8 A;  3AEV B;  4JI7 H;  2A1S A;  4JV5 H;  1VIG A;  4AQY H;  2K1H A;  2VQF H;  4DR5 H;  1K1G A;  2HH3 A;  2LF0 A;  4JI1 H;  4DR7 H;  2BL5 A;  4X66 H;  1X9Z A;  4LF8 H;  4B3R H;  3GKU A;  4DUY H;  4U1C A;  1F0X A;  2CTK A;  4LF5 H;  1XNQ H;  3L7Z C;  1DT4 A;  1X4M A;  3OSS D;  3V69 A;  4OD6 A;  4KHP H;  1IBL H;  1N32 H;  1PQX A;  3V1B A;  3J81 W;  4B8C D;  1V9N A;  2M6Q A;  2O4C A;  4QMF B;  5IWA H;  4NXN H;  4LFB H;  4FJU A;  4OO1 G;  4B3T H;  4PDB A;  2JE6 I;  2UXD H;  2DGR A;  4JI6 H;  2PT7 G;  4JI4 H;  4AM3 A;  4LFC H;  1E52 A;  2LTL A;  2UXC H;  2OPU A;  3T1H H;  2FPH X;  2YQR A;  4JI2 H;  5C0X G;  2PY9 A;  4WAN A;  5BR8 H;  4DV4 H;  4NZT M;  4LF4 H;  2BA0 A;  1HNW H;  2HHH H;  3V1A A;  2G8Y A;  3V1E A;  2E5L H;  1QOJ A;  3T1Y H;  4B3M H;  4DV7 H;  2QND A;  1WHR A;  1Z0K B;  4OX9 H;  1IBK H;  4LF9 H;  4JVH A;  2VKC A;  2MJH A;  3RF2 A;  4DV2 H;  1N34 H;  2ANR A;  5A2Q W;  2UUA H;  4BA2 I;  1AN7 A;  1XMO H;  1ZTG A;  4YY3 H;  1DTJ A;  1S03 G;  5JEA G;  1X0A A;  3U1K A;  1NXU A;  4X62 H;  5LMN H;  1IBM H;  2UXB H;  4DV6 H;  4X64 H;  1MSZ A;  3GR5 A;  4GKJ H;  3OET A;  3SB1 A;  3V1F A;  2CTL A;  4DR3 H;  2UUC H;  1XNR H;  4B8T A;  2OPV A;  2CWF A;  1FJG H;  4DR4 H;  2LRR A;  1WTJ A;  5DT9 A;  2A26 A;  2M8W A;  3JAM W;  4DUZ H; 
#chains in the Genus database with same CATH homology
 3KDG A;  4LF7 H;  5FLX W;  4DV1 H;  4LF6 H;  1N36 H;  3KDK A;  1HR0 H;  3PXG A;  2VQE H;  4JI8 H;  1I94 H;  4NZR M;  3QD7 X;  3GAB A;  2F4V H;  2UUB H;  1J5E H;  4DV5 H;  4JI5 H;  4DV0 H;  1N33 H;  2Y3M A;  4E9J A;  1XMQ H;  1HNX H;  1ODH A;  2UU9 H;  2ZQE A;  4EC5 A;  1I6U A;  3J80 W;  5IT9 W;  2ZM6 H;  4G08 A;  4DR6 H;  3J7A K;  3NCV A;  4JYA H;  3FAU A;  1FKA H;  4GKK H;  4JI0 H;  4LFA H;  4DR1 H;  5LMU H;  5LL6 b;  4YHH H;  1YSM A;  4DR2 H;  3OTO H;  1HNZ H;  4X65 H;  4K0K H;  4JI3 H;  2D9I A;  4NXM H;  4B3S H;  3EZJ A;  4DV3 H;  4OCH A;  1SEI A;  4JI7 H;  4JV5 H;  4AQY H;  2VQF H;  4DR5 H;  4JI1 H;  2LF0 A;  4DR7 H;  4X66 H;  1X9Z A;  4LF8 H;  4B3R H;  4DUY H;  4U1C A;  1F0X A;  4LF5 H;  1XNQ H;  3OSS D;  4OD6 A;  4KHP H;  1IBL H;  1N32 H;  3J81 W;  4B8C D;  2O4C A;  5IWA H;  4LFB H;  4NXN H;  2UXD H;  4B3T H;  4PDB A;  4JI6 H;  2PT7 G;  4JI4 H;  4LFC H;  1E52 A;  2UXC H;  3T1H H;  2FPH X;  4JI2 H;  5BR8 H;  4DV4 H;  4NZT M;  4LF4 H;  1HNW H;  2HHH H;  2E5L H;  1QOJ A;  3T1Y H;  4B3M H;  4DV7 H;  4OX9 H;  1IBK H;  4LF9 H;  2VKC A;  3RF2 A;  4DV2 H;  1N34 H;  5A2Q W;  2UUA H;  1AN7 A;  1XMO H;  4YY3 H;  1S03 G;  4X62 H;  5LMN H;  1IBM H;  2UXB H;  4DV6 H;  4X64 H;  4GKJ H;  3GR5 A;  3OET A;  3SB1 A;  4DR3 H;  2UUC H;  1XNR H;  1FJG H;  4DR4 H;  5DT9 A;  2A26 A;  3JAM W;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...