1ADNA

Solution structure of the dna methylphosphotriester repair domain of escherichia coli ada
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
b'MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPRQHRLDKITHACR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ADA 10
publication title Solution structure of the DNA methyl phosphotriester repair domain of Escherichia coli Ada.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 11
structure length 92
sequence length 92
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1993-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02805 Ada_Zn_binding Metal binding domain of Ada
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.10.10 Alpha Beta 3-Layer(aba) Sandwich DNA Methylphosphotriester Repair Domain DNA Methylphosphotriester Repair Domain 1adnA00
1WPKA 1ZGWA 1U8BA 1EYFA 1ADNA
chains in the Genus database with same CATH superfamily
1WPKA 1ZGWA 1U8BA 1EYFA 1ADNA
chains in the Genus database with same CATH topology
1WPKA 1ZGWA 1U8BA 1EYFA 1ADNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPK A;  1ZGW A;  1U8B A;  1EYF A;  1ADN A; 
#chains in the Genus database with same CATH topology
 1WPK A;  1ZGW A;  1U8B A;  1EYF A;  1ADN A; 
#chains in the Genus database with same CATH homology
 1WPK A;  1ZGW A;  1U8B A;  1EYF A;  1ADN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...