1U8BA

Crystal structure of the methylated n-ada/dna complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
131
Chain Sequence
MKDDQRWQSVLARDPNADGEFVFAVRTTGIFRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*AP*TP*T)-3'
publication title A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein/dna
total genus 36
structure length 131
sequence length 132
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
A PF02805 Ada_Zn_binding Metal binding domain of Ada
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1u8bA02
3.40.10.10 Alpha Beta 3-Layer(aba) Sandwich DNA Methylphosphotriester Repair Domain DNA Methylphosphotriester Repair Domain 1u8bA01
4A3IJ 2EZLA 2E2HJ 4Y7NJ 1ZR2A 3WHBA 2JA8J 5EYRA 2WB1N 4A93J 3HOXJ 3BQYA 1Y1VJ 4B1RA 1DU0A 1RKTA 4I76A 4XICA 2HOSA 1G2HA 3S1QJ 1NK2P 3IH4A 3VPRA 1MBEA 5EF6A 2E1OA 1X2NA 2LLKA 1JT6A 1EF4A 2E2JJ 3FKIJ 4GFBA 3K2AA 5IOYA 1OCPA 4M6VA 3I4NJ 2R92J 3JRAA 2RAEA 3GBGA 2HOTA 1ADNA 2GBYA 3PM1A 2R5YA 1RR7A 5JLWA 5IYBJ 2HDDA 4A3KJ 1K61A 3ZQCA 4DZPA 3NARA 3OSGA 1RESA 3FK6A 3JR9A 3MN2A 1I50J 4JP0A 2OF7A 5IYCJ 2LTPA 2LP0A 3SDGA 1JJ8C 3A03A 5GPAA 3Q3SA 3BTLA 2WAQN 1ZQ3P 4D7NA 1JKOC 1QRYA 4S0HB 2L7ZA 2XGEA 3G1MA 3HBLA 4A69C 4UUSA 4DW6A 1TC3C 2NVYJ 3FK7A 2GM4A 1MBFA 2DMUA 2X6OA 1JKQC 1F43A 2EH3A 1LFBA 1ZK8A 2I10A 3JRIA 1MSFC 2Y2ZA 2NOGA 3TEDA 5M5WJ 2DA5A 4A3LJ 4D5FA 2XSDC 1IUFA 4A3JJ 5FKKA 1AKHA 2L0KA 3CCYA 3RZOJ 4W97A 2CQQA 1JT0A 1MBJA 1ORKA 2HQ5A 1SFOJ 3GTQJ 3HGGA 1WI3A 1H89C 2K9QA 3JRGA 1CQTA 3S2DJ 5FKMA 1FTZA 4A3MJ 2VI6A 1WH7A 2WV1A 1YRNA 5M3FJ 1GVDA 4B4CA 1JUMA 1RPWA 2ECCA 3BTCA 3BR1A 2K40A 3S16J 1OJLA 1APLC 1VF9A 5IOZA 3TW7A 1S7EA 5EEAA 1BA5A 2QF7A 4MFEA 3D1NI 2H1KA 2R7ZJ 4QSHA 3BR0A 1GV5A 1B72B 2E19A 1FJLA 1I6HJ 1WH5A 4XRSG 2K9NA 2ECBA 3A02A 3BQZA 2O7OA 4Y52J 4X6AJ 1MSEC 2DMTA 3IH2A 3QQAA 2ID3A 2XB5A 2TCTA 4DYCA 2JA7J 3F0CA 1FIPA 2VPRA 2M9HA 4I6ZA 1OFCX 3BG3A 4JX5A 5GP9A 2XPWA 1MNMC 2L9RA 1AHDP 4M3DA 1BW6A 2VKVA 2CQXA 3HOUJ 4MIMA 2E2IJ 2DTZA 3TP3A 3CDLA 5F1JA 2M0CA 1TWCJ 1ETOA 1MBHA 2ELKA 3PO3J 2Y31A 2MW8A 4DZJA 3ZQGA 1UG2A 2DA2A 2IAIA 4MLOA 2ME0A 4JX6A 3HOYJ 2Y0SN 1UHSA 1VFCA 3E7LA 4V2GA 1Z77A 2X9DA 3S14J 1TWHJ 5EGOB 1JJ6C 2R0QC 2M34A 5GPCA 4MO7A 2ID6A 2JK3A 3LSRA 3SJMA 1GDTA 5HODA 2GLOA 1MH4A 2L7FP 3RKQA 3QPLA 2AO9A 9ANTA 3SFIA 3WHCA 1ZTRA 4CYCB 2FJ1A 5C4JJ 5EZHA 3BR6A 1GT0C 2LKXA 5BNGA 4NDLA 2DA1A 1IJWC 1ETWA 3I4MJ 5IYDJ 3JRFA 1JUSA 1PUFB 4M3BA 2HXIA 3FIWA 4B3AA 4HNVA 1BW5A 5F0HA 3HDDA 2XPUA 3ZOBA 3HOWJ 2M8GX 1IRZA 1UMQA 3OIOA 4BBRJ 2NVXJ 3UKGA 2IEKA 3BT9A 1WGXA 3HOVJ 3LOCA 5JLXA 2ME6A 2AHQA 3W6VA 4C3HJ 1GUUA 1BL0A 2HOAA 3MVPA 3DEWA 1QVTA 4XK4A 4BBSJ 3Q0UA 1HLVA 1IDZA 1LFUP 3JRHA 4JYKA 4BY1J 1POGA 3QPSA 3DCFA 3BG5A 1B72A 2XPVA 2QCOA 1OCTC 2H8RA 1ENHA 2CJJA 1A6IA 5J1YA 4FE4A 1AU7A 1T56A 1BJZA 1X58A 4FISA 1HOMA 2DMQA 5C4XJ 1ETVA 3TW6A 1ETKA 3JRCA 3O8GA 3GTJJ 2XRLA 4AC0A 1VNDA 3PO2J 2LFBA 2R93J 1D5YA 2HYJA 3L1PA 2YS9A 2FX0A 2G0EA 1W0TA 3LSGA 2JMWA 1T33A 2MGQA 2Y9ZA 2M2EA 1MH3A 4BXXJ 1FTTA 2FQ4A 2DN0A 1ITYA 1SANA 5IP9J 3OSFA 2K9SA 4ABZA 4X1EA 1IC8A 4FTHA 4L5EA 1FIAA 3HOZJ 3RZDJ 2N8GA 3HEFA 5F27A 4IHWA 2LD5A 3B6CA 3BR3A 3M3YJ 2DMPA 4G12A 3ZQIA 2EZIA 1I3QJ 1FEXA 5EGOA 5DS9A 3HGYA 3ZQFA 4DYRA 4C3JJ 3GTOJ 5M5YJ 3TP0A 5K7HA 4MFDA 3MKLA 5K7FA 4XRSA 1U9NA 5F04A 3IV5A 4A3CJ 5FLMJ 2W48A 4XRMA 2DA6A 5M3MJ 5EG0B 5C44J 1ZR4A 4BKXA 1IV6A 2HXOA 1H88C 3CQZJ 4QIWN 2NVTJ 2L7MP 4CYCA 5IP6A 5FJ8J 5J3LA 1R9TJ 3A01B 4AUXA 3JREA 3IH3A 2B63J 2XB0X 3GTGJ 2JA6J 2EZHA 3BTJA 2R5ZB 2DMNA 2DA7A 5F0FA 1PUFA 2LY9A 1Z0XA 4M3EA 5E3OA 3K7AJ 5EDNA 5FLVA 3S1NJ 1A5JA 3O8HA 2COBA 1DU6A 2LR8A 1RETA 2DA3A 1NK3P 2PMZN 5J1RA 1HDPA 1U9OA 2NVQJ 3LSPA 1XC5A 2DA4A 4FCYA 3G1LA 3LNQA 1B8IB 3S17J 1LE8B 3S1RJ 2X48A 4M3GA 1JTYA 1EYFA 1MBGA 4D7MA 1VI0A 4AYBN 5K7ZA 1O4XA 3C2BA 2KT0A 1JTXA 2Y30A 2VUMJ 3OOUA 3HB9A 1IGNA 4QTRA 3BTIA 3GTKJ 2MSYA 3JRDA 5FKOA 1E3OC 1WPKA 3H0GJ 1W0UA 2LVSA 1F36A 1P7IA 3LSJA 4W1UA 5FKLA 3JRBA 4A3FJ 1H8AC 3B6AA 3G1OA 4DYQA 4XIDA 2R5YB 1IG7A 2LK2A 3S2HJ 1NTCA 1QVUA 5EZGA 1ZGWA 4RBOA 5M5XJ 1HCRA 4IHYA 5E3NA 2MG4A 4V2FA 4EEFG 1Y1WJ 5E3LA 4BY7J 2JJ7A 3M4OJ 2JN6A 1WCMJ 1ETXA 3ZQHA 1U8BA 5DTDA 3GTPJ 5F0CA 1ZKGA 2IBDA 4LOCA 5FKNA 3GTMJ 2D5VA 1MBKA 2O9LA 1HDDC 1TWGJ 1TWAJ 4FE7A 2XGDA 1ETYA 1TWFJ 2EZKA 3FISA 1HF0A 1P7JA 2EBIA 2Y9YA 1Q1VA 4RDUA 4UUSB 1QPIA 1JUPA 1ETQA 4UUTA 3ZQLA 4A3DJ 1XS9A 3Q0VA 3Q0WA 2EQRA 2JWTA 3GTLJ 4J19A 3HKZN 1JKPC 2CRGA 2CUFA 3CMYA 2O8KA 1K83J 5IPAA 5E3MA 4C2MJ 5EG0A 1AKHB 3RQIA 1JGGA 1JKRC 4C3IJ 1RKWA 3A01A 2HI3A 4IHVA 3S1MJ 2ZB9A 1GV2A 4IHXA 3BR5A 5J1UA 3NAUA 2R5ZA 3H3VK 2DJNA 3BR2A 1U78A 2VKEA 3BG9A 2CUEA 4IEJA 1YRNB 2YU9J 2NS8A 3S15J 4A3BJ 2JA5J 1IDYA 4D5CA 3HM5A 4A3EJ 5F08A 2OPTA 2FD5A 2TRTA 4M3FA 2KDZA 2NS7A 4JX4A 1B8IA 1LE8A 2YUSA 5IP7J 4A3GJ 2P81A 2XGCA 5C3EJ 1X2MA 1XG1A 2CU7A
chains in the Genus database with same CATH superfamily
2HDWA 1OQYA 3QOEA 4E7IA 1ZR2A 3DPTA 3WHBA 2WB1N 5CYVA 2GAUA 2WV0A 1A04A 3I59A 2HZDA 2M30A 1VTNC 3GFMA 4KA4A 4F93B 1X3UA 2WY7Q 3ZXSA 1XB4A 1WJEA 3BG6A 2O0YA 3M8EA 1MBEA 1Z1DA 1WWXA 4KICA 3RPUD 3VPRA 4IHTA 3HPHA 1J5YA 1PP7U 4IJAA 2UZKA 1OCPA 3I4NJ 2VE8A 1F4KA 3K0LA 2RAEA 2QVOA 2WAFA 1XMAA 3I4PA 2HOTA 2GBYA 5JLWA 1RI7A 2HDDA 4UHTA 5F64A 1K61A 2BYVE 5GAEJ 2HYFA 3DLLF 3A0HC 5CKTA 1OLTA 2OV7A 1FBUA 4JP0A 1UELB 2F4IA 1PVEA 2RNGA 4WXCA 5GPAA 3Q3SA 3QYFA 5K5RA 2QA4I 3FF5A 5F6FA 1IV8A 1N25A 3BTLA 1ZQ3P 4P55A 1XN7A 4D7NA 3DKWA 1U5TA 3DV8A 1JKOC 1QRYA 2P7CB 3CMEI 2XV4S 2AS5F 2IA1A 1J9IA 1IN6A 1PYVA 2H94A 2HKXA 1UZCA 5J4VA 1KQ9A 4XQFA 3OMYA 1IN8A 2ICWG 3FM5A 1JKQC 2W57A 3K1PA 4F91B 2HS5A 5DUKA 4GXOA 1TW3A 4RAFA 1FYKA 3V8LA 5FGMA 4ZJZA 2M4KA 4BQNA 1SMYF 2H09A 5DYMA 3CCYA 4BJTA 4B44A 2VOPA 1E3HA 2CQQA 2JUGA 1MBJA 1ORKA 2HQ5A 2HNHA 4FT8A 2M1BA 3P9KA 3J81K 1WI3A 3GTQJ 1VQOI 1AA7A 3HL2A 5FKMA 2WV1A 4BACA 1S72I 4YELA 1I27A 2XAHA 1GVDA 3MFKA 2X6YA 4IQ4A 1I3AA 4Q47A 1TTYA 2Q2EA 3BTCA 4ITVA 3COAC 4XN3A 3TO9A 3TDZC 4CCKA 1I1SA 1APLC 3ASNH 3EUKL 5IOZA 4OIOF 1TT5B 1AWCA 2QF7A 4IRGA 3D1NI 2R7ZJ 4IL6C 2VOOA 1BM9A 3LSTA 2E19A 2VC1A 1Y6IA 5CVIA 1BI1A 1R49A 1ZLKA 3T0YA 3DFGA 4XR6A 1G4DA 4BHCA 4X6AJ 3AG1H 2DMTA 2FQ3A 1V3FA 2V9VA 2FRHA 3KFWX 2XB5A 1IN4A 2BVMA 2VPRA 2ZMEC 3LL7A 2X0LA 2A07F 3O2PE 4A2UA 3BG3A 4JX5A 4I6ZA 3SFZA 3ZQQA 5GP9A 5GTIC 3CUQA 1AHDP 4M3DA 2EILH 5IT3A 3Q5FA 1YFHA 2VKVA 1VQMI 3HOUJ 1S3JA 1R5GA 3HG9A 2E7WA 4F3QA 2KIMA 1JI8A 3CJTB 4KIBA 2DO7A 4Q4ZF 3L2VA 4DZJA 2KFDA 4LB6B 3ZQGA 4DOZA 3MCZA 2C6YA 4MLOA 1QO0D 2RQPA 3NQOA 1TL8A 1OCRH 2Y0SN 3TO7A 4MEYF 2E36A 2KL4A 4P9UA 3BC8A 3S14J 1TWHJ 1LEAA 2XROA 5EGOB 4CCMA 5GPCA 1KU9A 2P5VA 2R7UA 1FT9A 2P6TA 4WCGA 4FETA 2MFZA 2JK3A 3JW4A 1X1DA 4S04A 1YYVA 1MH4A 1SMTA 5DV5A 2IS6A 2CQ7A 1PDNC 1BOBA 2STTA 4P9FA 4LG3A 1R58A 1OYYA 3NWTA 5EZHA 4YFNF 1FX7A 3KP3A 1FY7A 5AONA 3PIPF 4A0XA 3DTIA 2L01A 2VBWA 4HDUA 1G3WA 3IP4B 3JRFA 1YO5C 2BHZA 2R4GA 1W5TA 2ESHA 1PUFB 4HDVA 3P9IA 4LIUA 3QU3A 3WTSC 3F8FA 1BW5A 3HDDA 3F9KA 1S29A 4BH9A 2KHMA 3U9GA 2BE5F 1O7LA 3OV8A 1XCBA 3REOA 4BUPA 4OOIA 4WF2A 3ZMZA 1HC8A 1UB9A 3OIOA 1K78B 4BBRJ 3UKGA 2PI0A 3SZGA 1WGXA 1D1BA 3LQQA 3LOCA 4KFCA 2HPIA 3A2KA 2MABA 5K5QA 4BE2A 1SAXA 4NUBA 1BL0A 4ANJA 3MVPA 1Z21A 3MZYA 1T38A 4XK4A 2FEZA 2JVGA 1QHHD 2GOXB 3S2WA 4Z2YA 2Z3YA 4G7HF 5E1XA 4JYKA 1K79A 2W24A 3R60A 2QCOA 3GFIA 3MZHA 3T5XA 1XDSA 1ENHA 2CJJA 2XGXA 4BHPA 4KN4X 3GFLA 1PJRA 4AIHA 5TJJA 4DGWB 1T56A 1OCZH 3GFJA 3I71A 3OYMA 1HOMA 1HSJA 2FMYA 4BGDA 2W4SA 2PFBA 1VQLI 1QQIA 1ETKA 4A5NA 1FMWA 4G7OF 3BZCA 3O8GA 4K2EA 4NC7A 3J7ZI 2XRLA 4AC0A 1MNDA 1T95A 1K6OA 4HYEA 1USTA 1EH8A 3KETA 3EYYA 3L2UA 3QP6A 4I99C 3FXJA 2LY2A 3V7CA 2HYJA 5D8LB 1S5LC 1HW2A 1A6QA 3M1EA 5HLTA 1RIOH 4AVZA 2E34A 2KKOA 5H6QA 1MH3A 5K1YA 5HNFA 1GXPA 2R7OA 1ITYA 1GLNA 2CW8A 5D5VB 5IP9J 4MGRA 1E2XA 3GLLA 5E20A 3R6SA 1EA3A 2EV6A 2WAQA 1YX3A 1I3QJ 4MNUA 3FXQA 5DS9A 2J5PA 2EWNA 2ACJA 1Y0UA 3IV5A 4N0BA 4KMFA 2DA6A 2EFWA 1U6GA 5BMZA 1Z3YA 2MC4A 2DFFA 3H92A 2VXZA 3P7NA 4ZTJA 5IP6A 1R9TJ 1XSVA 3A01B 4OMYA 3IL2A 3TKYA 3JREA 2B63J 1B6AA 1R1VA 2XB0X 1W36C 2JA6J 4H4KC 2FMLA 2HFHA 2LY9A 4N4OB 2JRMA 3K7AJ 4RAYA 5EDNA 3WU1B 3CO6C 2H6BA 3CF5F 1NK3P 2JT1A 3TGNA 2F4OB 1HDPA 3CCSI 4XLNF 1QU3A 4A6EA 1XC5A 4LIVA 4WXHA 3S1RJ 2X48A 3CJNA 1JTYA 1WJDA 4CCLA 1VI0A 1WQ2A 2VL8A 3OOPA 1R22A 1W5SA 4AYBN 2KRHA 1O4XA 2W82A 3C2BA 3G4SI 4IOAF 3T8RA 2HU9A 1IXRC 3ZMUA 3WGGA 4I0BA 2KJBA 3OOUA 3I59B 2CQNA 2QBYA 1IGNA 1K7AA 2CG4A 3PUFA 1XSXA 5E1WA 4E4HA 2EINH 4EM1A 5HDNA 1F36A 4XBFA 3LA7A 4A3FJ 1H8AC 3OYEA 2BXYA 2R7QA 4EJOA 2HZTA 3C18A 4DYQA 2QM3A 3EDPA 3H3UA 2GXBA 4XIDA 1N75A 1D8KA 3GWZA 3MZ8A 2ZJRF 1LVKA 5JR3A 2OD5A 5M5XJ 3W2VA 2Z2SB 1LNWA 3VYSB 2XKOA 1DDNA 1YLFA 2FU4A 4M9XA 3M4OJ 3O3KA 3GEZA 2EA4A 3OYBA 2UUZA 5F0CA 1JE8A 2JPCA 4LOCA 2R7TA 3GTMJ 2BZTA 4HOBA 3OY9A 2NNYA 2D5VA 1D0YA 1F9NA 1J59A 1U5TB 3PSIA 2EZKA 3KYCB 3OWTA 4HG2A 1L3LA 3GW2A 2EBIA 3OS2A 1Z9CA 3BOQA 3K4BA 1SD6A 2V4JC 4G94A 4L0YB 3T8TA 2E1NA 1Q1VA 1O7FA 3OYIA 4O3MA 3E0JB 2WC2A 3JCUC 3K4NA 3BJOA 3ZQLA 1I6XA 3ZN0A 4II2A 4J19A 4DNCA 4BNCA 2Y48A 2VKHA 3L00A 2M8EA 1W7PD 3FHNA 4TV7A 3MKYB 2CUFA 3F8NA 2PMZA 2O8KA 3CD6I 4EQQA 2B7EA 5EG0A 3QPHA 5J47A 3MAJA 4RMNA 2DT7B 4E70A 1X4OA 2OQRA 1RKWA 4IHVA 3S1MJ 4M72A 4ZH4F 2HPMA 1MGTA 1RUOA 3WTUC 2V6CA 1ZN2A 3BR5A 1K4TA 5J1UA 3NAUA 2R5ZA 3M1CA 3BR2A 4ZTFA 2VKEA 3MKWB 5E18F 3HSFA 2NS8A 4A3BJ 2QYOA 2Q2EB 1TNTA 3GMEA 4RB3C 4L5IA 5LRSA 3EUAA 2K4BA 1LB2A 1HW5A 2P8TA 5F08A 2OPTA 2FD5A 2PEXA 2TRTA 4CICA 4JX4A 1LDJA 1B8IA 1LE8A 2R7VA 2G7UA 3O6BB 2YUSA 1X3WB 5C3EJ 1P4AA 2GIVA 5LLQA 2O6GE 1ZYRF 3PJRA 2LSOA 2BBYA 2L02A 4KUMA 2MLGA 3EYIA 4Y7NJ 3AAFA 1OPCA 4II3A 1USSA 2X6WA 4ZYHA 3FXKA 4BJ6C 3S3MA 4UXNA 2OQGA 5D4SA 4A93J 1T8IA 2ZNYA 3RTRA 1Y1VJ 3MMYB 3K9TA 3LA3A 1WSUA 3H0DA 4RGXA 3E6DA 1B59A 4HF0A 1NK2P 3IH4A 1VQKI 1VQ8I 1K6YA 3HRTA 2ZFWA 1I5ZA 5EF6A 4RGUA 1X2NA 1K78A 2LLKA 1JT6A 3FKIJ 2VE9A 1T0FC 5IOYA 4BQOA 3CO7C 4M6VA 2EFOA 4BL0B 3JRAA 1V5GA 1YIJI 4IXAA 3GO5A 3PM1A 5CVJA 1VQ6I 4A3KJ 3ZQCA 2F5DA 3OSGA 4ZYAA 1I50J 1D1AA 3DP7A 3CCLI 2X4HA 2YR2A 2LP0A 2QLZA 3SDGA 4ZYGA 2D45A 3F6OA 4UNOA 4ZC3A 2A5WA 3B73A 3IC7A 2ADUA 5LBQA 3CC7I 2ISYA 1KU7A 3V7RA 1T6SA 3LSMA 5LFAA 1UHWA 2W00A 1MNEA 2E1MC 2IGNA 3HBLA 4YIIA 4A69C 1P4XA 1O3TA 2ZXIA 2RN7A 3H35A 4Q48A 4U0WA 5ICGA 3F8BA 3M07A 3FK7A 3H36A 2DMUA 4PFPA 4N9IA 1ZK8A 2I10A 1MSFC 2HGCA 1SD5A 3VODA 2DFIA 2ELHA 2H1LA 1S9HA 1YE9A 5HLGA 1QGPA 3FWEA 3C2GA 3SXYA 2L54A 3R0AA 2IGKA 3RZOJ 2M3AA 3KP2A 3ZRGA 3PQJA 1MMNA 4PJMA 4OIPF 1SFOJ 3HGGA 1H89C 2F5VA 2ZSHB 3D5RC 3HJEA 5CQEA 3JRGA 1XD7A 4UB8C 4O6JA 4PJJA 1DGRM 3A1YA 1FPQA 4A3MJ 1ZRDA 1QPMA 5LGNA 4CXFA 1JGSA 2QKMB 2P7VB 4OAZA 1CF7A 5ICCA 1YRNA 1OCCH 3KEQA 4R8HA 5M3FJ 1RPWA 2ELJA 2LYCA 4B43A 5CVRA 4OINF 2WBMA 2FOWA 4H0EA 4CH7A 4WWCA 3ZMTA 1OJLA 1VF9A 1IXCA 2X51A 4IOCF 4NQWA 1S7EA 3HSRA 1Z7LA 5CVVA 2PLYA 2M45A 2Z5UA 1S6LA 4UY8I 1SAUA 4OWRB 3JTGA 1ZARA 4HX4A 5DM6F 4OU0A 1I6HJ 3J80Z 2L3DA 4PGGA 4MHGA 1A35A 2ECBA 2OJED 1E3PA 3KP7A 5FLXK 1D5VA 3BQZA 5D6FA 2CO5A 3FHZA 4Y52J 2OZ6A 2BY0A 3L2CA 2EV0A 4HX8A 2ID3A 2JPBA 3WG9A 1ZLJA 2TCTA 4JK1X 1G59A 3F0CA 4BYYA 2M9HA 3FXLA 1BI0A 2EJRA 3MQ0A 2XPWA 3VYTB 2DPUA 3RCOA 2QZ8A 2Z9OA 2E2IJ 2DTZA 3CDLA 1TQPA 4PJLA 2IS4A 3CCRI 1RC9A 4F7ZA 1X1CA 1W36D 2VIXA 2KLOA 2BW3A 2MW8A 1LUJB 3KZZA 1DPUA 2L9SA 1ZG1A 3TDUC 5D5UB 4JX6A 3HOYJ 4E7ZA 5L3GA 1MZBA 3E7LA 1TW2A 3U21A 2IA2A 2DPDA 2R0QC 2M34A 2XIGA 3CMMA 3OYFA 4ON0A 3LSRA 3SJMA 2GLOA 2BY2A 2XAUA 1OYWA 2K02A 1Y0NA 1FC3A 3CUQC 4BU2A 1MDMA 3RKQA 3QPLA 3E5XA 2QQ9A 3WHCA 5FRMA 4CSWA 4U7DA 2JUCA 4C9YA 3HZJA 4RGSA 1GT0C 2LKXA 5BNGA 5E8GA 2B9SA 2V7FA 1ETWA 3I4MJ 3HRMA 1IRGA 4HEA2 1H9TA 3GZNB 1U8RA 2HXIA 2KIFA 1RR8C 5FFZA 4B3AA 2PBIA 5B3SH 3WGHA 4G7ZF 2XPUA 2BY3A 3BG7A 2VXDA 1XSDA 1JHFA 3OR2C 1MMDA 3WGIA 3F3XA 5HDGA 4XLCA 1GVJA 2XF7A 2IEKA 1YITI 2HQNA 3K1NA 3ZMDA 2PJPA 3K4CA 1T08B 2AQEA 2IVMA 2CUZA 4HA8A 2AHQA 3DU5A 3K10A 4D0PA 2TDXA 4C3HJ 5HNHA 3GYHX 3TL4X 1TNSA 3CP8A 3Q0UA 1ZG3A 2K27A 4E6KG 1HLVA 2QBYB 2K4JA 4BY1J 3JRHA 3G71I 4CA0A 1POGA 5GTHC 4HRIA 3DCFA 1R23A 2H6CA 2H8RA 2A5YB 2K5CA 3SEZA 2AXLA 3BLYA 4XL9A 1A6IA 1D3YA 4MEXF 4HQEA 2KRFA 4HSRA 4DIQA 1G3YA 4HX7A 3I5UA 3FXOA 1X58A 1XGOA 2DBBA 5HS9A 3H1CA 3MWMA 3ABLH 2A05A 2NRAC 5ERIA 1ZREA 2L5QA 3GTJJ 1SFUA 3FDYA 3OS1A 3ERMA 2LDUA 2LFBA 4RGRA 3QP5A 3OL3A 4XRFA 2R93J 2O61A 4YG2F 3IHUA 3LMMA 1DP3A 2KJCA 1Z6TA 2KRCA 4EATA 4EGYA 3QPTA 3EQLF 3IRRA 2FX0A 3DTEA 2G0EA 2K9LA 2EB7A 2CFXA 3LSGA 4AD9A 1W0TA 2RREA 1CGPA 2RKHA 2G7HA 3HYIA 1Q1HA 2L2OA 1YI2I 3RDIA 1XPXA 1SANA 2E60A 3JTHA 3OSFA 2DOFA 1LFPA 4ABZA 4E7KA 5AIQA 3LAPA 3PUBA 1D0ZA 4FTHA 4L5EA 1FIAA 2QQBA 3RZDJ 2N8GA 3J80K 3ELKA 1ZGAA 4GO1A 1HKTA 2CS3A 2EZIA 4ZDOA 1FEXA 2DW4A 3HGYA 2MA3A 2NS0A 4C3JJ 2LOOA 3VOEA 5K7FA 4IF4A 4A3CJ 2F5EA 4IRHA 2VN2A 2JSPA 5FLMJ 2W48A 1J7KA 2CFOA 5EG0B 4MTDA 2HTSA 1IV6A 2HXOA 4ZYEA 4QIWN 2NVTJ 2MLKA 1RRJA 3M9AA 1O57A 4AUXA 4DQ2A 3PQKA 3GTGJ 4BE0A 4ESBA 3WTTC 2MH9A 1YJNI 3BTJA 3KYDB 2R5ZB 2WAEA 2XASA 5E3OA 1I1GA 1REPC 5FLVA 3PFIA 4NBQA 1A5JA 2DYRH 1DU6A 3AL0B 1X19A 1U9OA 1ZHFA 2V9KA 3LSPA 4FCYA 5J6XA 1B8IB 3S17J 1LE8B 3K70C 1DUXC 4QPOA 1MMAA 1MBGA 4M6XA 1WJBA 1YW8A 1SVMA 4D7MA 3LQRA 3RYRA 3D5SC 1BN5A 1IO2A 2PMHA 3TO6A 4L18B 2Y30A 2VUMJ 4YRVA 1KONA 2E35A 3DXJF 2KMUA 3PIOF 3HB9A 3CCJI 3KYLA 4F52A 4B48A 5KCMA 3OYJA 3BTIA 3JSPA 2CGPA 3GTKJ 4NB5A 5EEHA 1VQPI 3W2WA 5L3FA 3HC7A 2DT6A 2FA5A 3PNYA 5FKOA 2PN6A 3E5QA 4KITB 1T39A 1E0EA 2CW7A 2VJJA 3JRBA 3QODA 4U87A 1FOYA 1MW7A 1Z7UA 3KPHA 3DBLB 3DF8A 3K2ZA 3BDDA 1IG7A 2KZGA 1ON2A 1O3RA 1M1EB 5A2QZ 2KIUA 1LDKB 4IHYA 2R7DA 2P5LC 3LFUA 5LEJA 3VFZA 2LKSA 3BP8A 4OIRF 1Y1WJ 5E3LA 4DBQA 3TBIA 4Y4RA 3ULQB 2FUG2 1WCMJ 4KJZA 3OYNA 2VQHA 1G3TA 2NYXA 2RGVA 1ETXA 3ZQHA 1U8BA 5DTDA 1V54H 2LKPA 4YIRX 2M5WA 1W7PA 3DKXA 4IKFA 2O9LA 1OR7A 3QAHA 4EV0A 3SEQA 3NRVA 4C30A 1ETYA 4FHTA 4NC6A 3WU2C 1XCVA 4CZCA 2DI3A 1ZH5A 3IRQA 2Y9YA 2VASA 3HOTA 2EV5A 1QPIA 4RDUA 4UUVA 2LMDA 4XLFA 1XS9A 3Q0WA 2EQRA 3V7SA 1Z3XA 2X6XA 3FXMA 1TLHB 4AIKA 4HLYA 2V9PA 3BJAA 1K83J 5E3MA 1FZPB 5D4RA 3OL4A 5B1BH 1IF1A 5IY5H 3VSLA 3M8JA 5DD8A 3G73A 4BS9A 2YX4A 4B47A 1Y39A 2HI3A 2ZB9A 4I09A 4KISA 2L4MA 1DQUA 1SVLA 2X1CA 3GZ5A 4ENNA 4EMSA 1DPRA 1VZ0A 5LHIA 2CSOA 2DJNA 2ZJ2A 1CF7B 1YRNB 3K4JA 3CDIA 1W5CC 2QWWA 4HLXA 3S15J 3CESA 1ZRFA 4XMYA 1IDYA 3IWFA 4UV8A 3D0SA 3E6MA 4LLGF 3HM5A 1KYWA 4A3EJ 4CCOA 4NQWB 4EGZA 1KYZA 2NS7A 2Y0MA 2HOEA 5IP7J 1TQIA 4A0YA 3M7GA 2BVLA 1X2MA 2L9NA 1MD0A 4JOMA 2RNJA 3J7YJ 3FMSA 2CU7A 1U3EM 4A3IJ 2XAGA 2EZLA 2E2HJ 4IVNA 2F5FA 3KE2A 2HVSA 2JA8J 5EYRA 1P4WA 2MBFA 2GOMA 2KDOA 3KP5A 3QOPA 1F5TA 3BQYA 3FM3A 4WK8F 1DU0A 1G2HA 2GA2A 2R7WA 2A69F 1TZLA 3S1QJ 1ERDA 3RYPA 1OCOH 1QHGA 1WFXA 4RB1A 2FE3A 1FP1D 3OIQA 5FO5A 1YW9A 4GFBA 2XRNA 4A5MA 1FSHA 2R92J 4WXDA 1RNLA 3GBGA 1ADNA 5HS7A 2R5YA 1RR7A 1J75A 5IYBJ 1BI2A 1F1ZA 3DTKA 3LSKA 4DZPA 1E17A 1FP2A 2BW3B 4A0ZA 3JR9A 3MN2A 4Y17A 2HR3A 5J4YA 3IWZA 3KEOA 3DPLC 1B1BA 2EPFA 5L3BA 5IYCJ 3L2QA 2BV6A 4M71A 1JJ8C 3A03A 4PFOA 4Z6YA 4EM2A 2EK5A 1KQ8A 2P6SA 3FKJA 2XVCA 2WAQN 2VKDA 1RZ4A 4S0HB 2CV1A 2L7ZA 4QLCU 1FYLA 2RC4A 1Z05A 4QWQA 3HRSA 4BDYA 3G1MA 4V19K 3H3ZA 4G8XA 5GAHJ 1MDMB 1YJ9I 2VLAA 1RUNA 1Z91A 4UUSA 3P9CA 4DW6A 1N77A 2GM4A 4HPQA 4NNJA 2ZXHA 3RPQA 4JBAA 1IZ1A 1XGNA 2EH3A 1HA8A 2A68F 1LFBA 3KX2A 3JRIA 2K3FA 2NOGA 3ISPA 3ABTA 3WU0A 4BJ5C 2WADA 5E79C 2OC6A 4U7BA 4D5FA 2AQFA 1IUFA 3RKWA 3H5AA 2X1DA 5BPIA 5FKKA 4ESJA 5A2QK 1W1WE 2EIJH 2L0KA 2F48A 1P6RA 4HV5A 2ZSIB 1JT0A 2FF4A 2BOLA 4Y15A 2PMUA 2M7AA 1S8NA 2E5NA 2WA0A 3OS0A 3MEXA 3AKZA 2P5KA 1FTZA 3ABMH 1WHUA 4RAZA 1UJ8A 4XN0A 5BOXA 4QPQA 2XSJC 5L3DA 1V5EA 3WTZA 2IRFG 4M73A 1NG6A 2ECCA 4B4CA 4LLNA 2YPRA 5DD4A 3CLOA 3BR1A 2K40A 2Z99A 3DWLE 2FBKA 2NXNB 3R61A 3TW7A 2COMA 3RQ4A 1BA5A 2AXTC 1XMKA 4MFEA 4QSHA 2FSWA 4HQMA 1R4NB 1ZELA 4PSWA 1LEBA 1WH5A 2BGCA 4YFKF 3I56I 1WVRA 4XRSG 1A31A 2K9NA 3DPUA 2HWVA 3K69A 3BZKA 2L7KA 2QSHX 2J5OA 2E71A 4RM2A 2KZVA 1MSEC 2QGUA 3BPXA 3IH2A 2DDAA 4N4NB 1KU2A 4CO8A 4DYCA 3TQNA 3RPUA 3ABUA 4XLEA 4B09A 1OFCX 3PFYA 2VQLA 2D2WA 3FMQA 2MD5A 2KP6A 4RLFA 4CYDA 4EJTA 2VONA 2L9RA 1BC8C 4MIMA 2M4GA 3ZP5A 3S93A 2V1XA 5H2FC 4HF2A 3L9FA 2DT5A 2LH9A 3SDBA 2ZC2A 4BQAA 3FMRA 1TWCJ 3W6KB 2ELKA 2KQRA 2O03A 2XAFA 2Y31A 2FBHA 2V79A 2HYGD 1XGSA 2IAIA 5LGTA 2ME0A 3FXRA 4EVIA 3VWBA 2JSCA 5LD2C 2ZJQF 2Y75A 2A3SA 1T98A 3CP2A 1SFKA 1LKXA 3P5JA 5AIPA 4GCVA 4V2GA 5BS6A 2Z1DA 3FBNB 2DDBA 2DXIA 3K70D 1JJ6C 1HKQA 1MJ9A 2ID6A 4ENMA 1GDTA 5HODA 1XX5A 2DODA 4CUGA 3F6VA 4XNFA 3HHHA 2AO9A 9ANTA 3AG3H 4BQQA 1ZTRA 4S05A 2Q0OA 2FJ1A 2HVRA 2CH0A 4RM3A 3HKZA 1WJCA 3V42A 4J01A 3BR6A 4C2UA 3HUGB 4ZZLA 1YQAA 5IYDJ 2UV1A 5KK1A 2OCCH 2A6TA 1ZRCA 2GQQA 2LBFA 1HXDA 5F0HA 2D1VA 3EUHA 2VBXA 2GXAA 1FOXA 2ZXWH 3S8PA 1UMQA 3DLAA 4P1WA 2NVXJ 3CCVI 2GXGA 3HOVJ 3BT9A 4ETSA 1P92A 3W6JB 4XKCA 3V8JA 1EH6A 3HPGA 5JLXA 2ME6A 2LF7A 5IT9Z 3D5LA 1GUUA 4HV6A 1UG0A 2OA4A 3CJQB 4CZZA 2LNBA 2NOJB 4I02A 3H9QA 3DEUA 4KYWA 1VQ7I 5FROA 1IDZA 3GLXA 4U0VA 1LFUP 1SEUA 1FLIA 3QPSA 3C2HA 2LY1A 3BG5A 2XPVA 4O5VA 4YEJA 3PNVA 5ICFA 3J81Z 1B72A 1OCTC 1U5TC 1YX5A 5ILSA 2WB1A 5J1YA 2VT2A 1R7JA 3WTYC 4L9TA 3EETA 4ENJA 3DBRB 4RA2A 3VYRB 1BJZA 1XDUA 3A0BC 2MYSA 5HLHA 3WTWC 4FISA 3N05A 4LD5A 2DMQA 3KIOA 3TW6A 1R1UA 3F72A 3JRCA 3SZTA 3MKZA 2IP2A 4B3XA 5JFRA 1TP4A 3L2WA 1IW7F 5DUIA 4B8XA 5D5WB 3PO2J 2FNAA 3WG7H 2LC2A 1HKSA 4XONA 2VC0A 4BEHB 4PK4A 1FYMA 3X2QH 1JXSA 1FMVA 4XKBA 3RJPA 3LWFA 2JMWA 5J8FA 1O3QA 2EIMH 1T33A 1W7PB 2IJLA 2Y9ZA 2ZNZA 2A6HF 2M2EA 5FFXA 4KT5C 1NH3A 2HQAA 1JHHA 3H9JA 2DN0A 3NWSA 4IPAA 1FTTA 5ILVA 1KA8A 2ZJPF 2IS1A 2XHKA 4X1EA 3G3ZA 2STWA 3ZN1A 3OYKA 3HOZJ 1KGSA 3KLNA 4GDFA 2CWEA 5FD6A 4DBRA 3JAMZ 4G12A 2VQCA 4D9JA 4PJNA 4RB2C 1X1PA 2ZMEB 1TQMA 3ZQFA 2I8DA 3R4KA 4P96A 3CCQI 2DK8A 3I3LA 5K7HA 1R36A 2VJIA 4MFDA 4XRSA 4LG0A 5C44J 4XRMA 2XC7A 3FXUA 3RI4A 1KZHA 3HXLA 3K4MA 4BKXA 1QZZA 4A12A 3CQZJ 2L7MP 4CYCA 2HTJA 5FJ8J 5J3LA 1U0JA 5B1AH 5CPRB 5LGUA 4ASNA 4JQFA 3HOSA 1MMGA 4IRIA 3IH3A 1YJWI 1A36A 3OYCA 2DA7A 5F0FA 1STZA 3QWLA 1MKMA 2LR8A 5E8IA 3HIFA 4F55A 1D0XA 1LJ9A 1VQ9I 2HVQA 3FX3A 3LAJA 3G1LA 3GCMA 3LNQA 2IS2A 5EEGA 4M3GA 3I9V2 1EYFA 2RQQA 2BY1A 2K3PA 2K9MA 5K7ZA 2BXZA 4RB0A 5FRNA 4U0YA 1JTXA 2KT0A 1WZ2A 1WKMA 4GYGA 1YS6A 4L0ZB 4HF1A 1I39A 1SVOA 2RVCA 5HOOA 4QTRA 5HDKA 4HSTA 3VSKA 3ZPLA 4BAYA 3JRDA 3SYTA 1WRJA 2V1UA 2WWYA 1E3OC 1OKRA 3LA2A 3V8KA 3PNTA 4CCNA 3H0GJ 1R5ID 4XLHA 1P7IA 4W1UA 4AIJA 2FBIA 2ESNA 2R7RA 2M0MA 3B6AA 2H27A 3QYEA 3KEYA 2R5YB 3MD2A 5TISC 2LK2A 2E1CA 1NTCA 1QVUA 5EZGA 1BOAA 4I7HA 1ZGWA 4RBOA 5CJ9A 1HCRA 5E3NA 4GRIA 3C7JA 4PGHA 4EEFG 3DU6A 4BY7J 2JJ7A 4E7SA 5LHHA 2JN6A 2O5RA 2QUFA 2K7LA 2DJIA 2ZXJA 3L7WA 2FXAA 4G6DA 3VYUB 3OYGA 2R7XA 2ZFUA 2IBDA 1V4RA 5IT9K 2B0LA 5FKNA 3E97A 3SZPA 5HS8A 3CC2I 4AVPA 1SFEA 1TWGJ 1TWAJ 2XGDA 4I0AA 1TWFJ 3FISA 1HF0A 1P7JA 4XKWA 2PG4A 2Y0SA 2OTJI 4E7HA 3S3OA 3KP4A 1FBQA 4UUSB 2PX9A 1FOKA 4XM3A 1ETQA 4A3DJ 4HW0A 1Y8RB 2VJ4A 3ZGKA 2ETHA 2W85A 2VB6A 3GTLJ 1JKPC 4I01A 1KU3A 2L4AA 2CRGA 3ONQA 3CMYA 2KPMA 1BR2A 3RQIA 4GYIA 4KDPA 2LG4A 1JGGA 2GZWA 5D8KB 2GA1A 1GV2A 3AG2H 4LLLA 3ABKH 4IHXA 1OR7C 5E17F 3GXOA 4KIGA 4FX0A 1U78A 1YG2A 4I2OA 3BG9A 4IEJA 3IUOA 2KISA 2YU9J 1AOYA 1OMIA 1N78A 2JA5J 2Q1ZB 4KIFA 5LRRA 4D5CA 2MD0A 4IHSA 4PJ0C 3JAMK 1XG1A 2W7NA 3HUGA 2LRDA 5DCMA 1GHCA 1U2WA 2NVUB 4ENKA 6PAXA 3HOXJ 4BXUA 3I55I 2HOSA 1SD7A 2M7BA 1RKTA 4I76A 4B1RA 4XICA 1R71A 2JRTA 2PJRA 3ML6A 3ZCOA 1H0MA 2E1OA 1B4AA 3HSEA 4Y33A 1EF4A 2E2JJ 1J2XA 2VBYA 1IRXA 3K2AA 2D1HA 3G2BA 1J09A 2IT0A 2R7FA 3OIPA 1S7OA 1IUYA 2V6EA 1BBYA 4HZFA 3BWGA 4AIDA 1H9GA 1YOVB 1QZYA 4KN7X 4BE1A 4EM0B 1S7AA 2XUBA 4MQ9F 3AFHA 1OISA 2O3FA 3NARA 3ECOA 3TOAA 1RESA 3FK6A 3WODF 2L9VA 3DQVC 3ECHA 5HVQC 2Z33A 2OZUA 1IN7A 2OF7A 2LTPA 4BDZA 2W1OA 3E6BA 3FBIB 2K85A 4PDKA 3LFKA 2QKLB 2VPLA 4KMUX 2XAJA 2Q8KA 1IN5A 4R79A 2XGEA 3JSOA 3IKVA 1XTAA 3V4GA 4EJUA 3Q9SA 1TC3C 2HQRA 2NVYJ 1MBFA 5ED4A 2F6CA 2X6OA 1BIBA 2FNPA 1F43A 3PSFA 5JHUA 5J8CA 4BEHA 4E7LA 2Y2ZA 1HQCA 3TOBA 3UR3C 4MTEA 4ZDPA 4XKVA 2DA5A 5M5WJ 3TEDA 1FNNA 4A3LJ 3BPVA 4NC8A 2XSDC 4A3JJ 1AKHA 3ROUA 2W25A 4W97A 5H20A 1ON1A 2LBFB 3CF2A 3TMOA 3F23A 2K9QA 3S2DJ 4I98B 2IGOA 2VI6A 2OTLI 1WH7A 4UV9A 1BI3A 2DU9A 4FQGA 4L9JA 2R3SA 1R6RA 4PZJA 2ZMEA 5TRDA 1EJ9A 1HBXG 3K4KA 1B9MA 1BR1A 1JUMA 4LB5A 4WX9A 3BCBA 4Q5SF 3K1MA 1HSTA 2VODA 1ULYA 3OYLA 5HLIA 3S16J 4U88A 1FSEA 5EEAA 2DQRA 5GAGJ 2XDVA 1EV7A 1IRFA 1Z67A 3CZ6A 2H1KA 5LHGA 3BR0A 4AYBA 1GV5A 1B72B 2WY8Q 3HRUA 4RS8A 4XORA 1FBSA 1FJLA 3A02A 1O3SA 1X1AA 3W2AA 4IX7A 2O7OA 4OIQF 1QZEA 1EH7A 3H9GA 4LITA 1ZGJA 1W4MA 1UCRA 1LVAA 3F8CA 3QQAA 2F5CA 2JA7J 1FIPA 2IPQX 3E3VA 4KNYA 5CVUA 4M9ZA 2DFHA 2XF5A 4HNTA 4HBLA 1MNMC 1Y56A 3DEEA 1BW6A 4UB6C 2VJ5A 5J40A 5LEKA 2CQXA 2XAQA 2DTRA 4ZDLA 3TP3A 5FB2A 3S32A 5F1JA 2E7XA 3ZQ7A 3E5UA 2M0CA 1TBXA 4X0GA 4CGZA 5FD5A 1ETOA 1MBHA 3BJ6A 3J7AY 3IAM2 3PO3J 3RIRA 1D8JA 4RAGA 1UG2A 2DA2A 5GADJ 3M8FA 1MMSA 4M6YA 4XOPA 1UHSA 1VFCA 1X1BA 1BIAA 4M9SA 4OMZA 1QNTA 1ODDA 4EJVA 1Z77A 1ZAOA 2IW5A 2X9DA 3W3CA 2VQGA 1K4SA 5KAIC 2ISZA 1R00A 3AL0C 2DFEA 3CDHA 4N9HA 2OUMA 4IQJA 4A6DA 2NAZA 4MO7A 5L3CA 1DGWY 4CHUA 2MH2A 4LG0B 3KLOA 4LK1F 1V55H 2CYYA 1IAWA 2L7FP 2I5UA 5DCFA 3CTAA 1G3SA 4L9VA 4ZZDA 1D1CA 2ZBKA 3CJRB 3SFIA 3GX4X 4CYCB 1NHAA 2V1DA 5C4JJ 2F4MB 2CW0F 3HHGA 3SQNA 3GVAA 3H5NA 5B5EC 2M87A 3BCAA 2LREA 5BQTA 4NDLA 2DA1A 1IJWC 2DQLA 1JUSA 3A4CA 4M3BA 3WE2A 5KHDA 3CMAI 2QENA 1YTYA 1C0WA 3FIWA 4LK0F 1HW1A 2FOKA 1BJAA 4XLPF 3QRFF 3U1DA 4HNVA 4ESFA 2OU2A 1FWZA 3WTXC 1PP8F 3ZOBA 3HOWJ 2R7SA 2M8GX 1YS7A 2Y69H 1LPQA 1IRZA 4XLAA 2DLLA 2H8WA 2E1MB 2JA2A 1LQ1A 2DK5A 4YIFA 3VDXA 2LF8A 3QYBA 3U1KA 1VQ4I 3W6VA 4XOTA 2HOAA 2UWMA 3DEWA 3LSHA 1QVTA 3RSNA 3I54A 4BBSJ 3BROA 2UXXA 3S3NA 1SFXA 4LFUA 3VB2A 2GIZA 3FZVA 3K6GA 1PUEE 4AU7A 4FE4A 4G6TB 1AU7A 2EFPA 2Z16A 5EJCA 3EUHC 1J0RA 4UVBA 1Y8QB 2QQAA 2XF6A 4OAYA 5C4XJ 1ETVA 3EPZA 3CLQA 4L9NA 2MC3A 1WJ5A 1MIJA 1VNDA 4M74A 5DDGA 3NEUA 1ONVA 1R4MB 1D5YA 3GUDA 3CCUI 3L1PA 2YS9A 5BPDA 5KVRA 4IO9F 2CV0A 2MGQA 5JVTA 5FLXZ 4BXXJ 2V26A 2FQ4A 4GGGA 4BXFA 3DBHB 3I0TA 2K9SA 3OR1C 2QQ8A 2DOAA 2DAOA 4LGWA 3U2RA 4CDGA 3J7AO 3WTVC 1IC8A 2ZKZA 5KNLA 3IKTA 2X85A 2E5ZA 3HEFA 5F27A 4IHWA 2LD5A 3B6CA 3BR3A 3M3YJ 2DMPA 3KZYA 3WE3A 2EIKH 3BY6A 3ZQIA 3KP6A 5EGOA 4DYRA 2DOEA 3GTOJ 5M5YJ 4Y13A 3TP0A 3MKLA 1U9NA 5F04A 3IAS2 5M3MJ 4MQVA 1ZR4A 2CMPA 5D6EA 1H88C 1YW7A 1X4PA 3HTSB 2YSRA 4RLQA 3CC4I 1MJAA 2PQ8A 5ICEA 2JVHA 3CCMI 3UNGC 1KQ0A 2EZHA 2DMNA 4NHJA 1PUFA 2JQ7A 1WJAA 4BHBA 1SC7A 4AWXB 1Z0XA 4M3EA 2HDCA 3S1NJ 3E1SA 3O8HA 3G6EI 2F2EA 4HNUA 2COBA 1RETA 2DA3A 2PMZN 4PCQA 3B02A 5JHFA 5J1RA 4D1QA 2NVQJ 5KAFC 1GXQA 2DA4A 3ASOH 4PSXA 2O8XA 3OYDA 1WI9A 3N97A 2EA2A 5JVGF 1P2FA 2QEXI 3CUQB 5ILUA 2UXNA 3N4MA 2OBPA 3F8MA 5DCMB 2IXSA 1LDDA 3GZ6A 2CV2A 2V1NA 4L5JA 4UVAA 1EKEA 1NG7A 4DJAA 2IGMA 3E6CC 2PJRB 3L09A 3KZIC 4R1HA 2A6EF 2XKPA 2MSYA 2A61A 1UFMA 4Y3OA 2BEOA 1WPKA 1W0UA 3F21A 3R0JA 5CLSA 3KCCA 2LVSA 3LSJA 2CQKA 5FKLA 2QSFX 5E1ZB 3AG4H 3OYHA 3G1OA 3K4LA 5L3EA 2ZO4A 1DP7P 1V5FA 5TGTA 1Z6RA 1T2KA 2RDPA 4LMYA 3S2HJ 1FOWA 4KT6A 1G6NA 4P5OA 1VQNI 2OAZA 3SHFA 3F22A 1G8XA 2MG4A 1B9NA 3ZR8X 4HAMA 4V2FA 2HEOA 2JTVA 2P0WA 3ZMVA 1ZG5A 3I64A 3VEPA 3LSIA 3BZ6A 1BR4A 2W84A 5B66C 3OYAA 1UHMA 3GTPJ 5K5OA 5H6RA 1ZKGA 2QSGX 4XSXF 4J00A 1TT0A 2YX7A 3I58A 1UAAA 1MBKA 3ZMSA 1HDDC 2EFNA 4UVCA 4FE7A 2VBZA 2IA0A 1IXSB 4EJWA 1L0OC 3RKXA 1QA6A 2HKOA 1BC7C 3T1BA 3ESWB 3RKYA 1JUPA 4XSZF 1SD4A 3H5RA 4UUTA 1ACIA 3Q0VA 1CQTA 2JWTA 1XMXA 2G9WA 2EFQA 2RV8A 3HKZN 4F92B 2BHYA 4FASD 5IPAA 3C3WA 5JI6A 4C2MJ 1AKHB 3C1DA 5DM7F 4PUSA 4FX4A 1QBJA 1JKRC 2WTEA 4C3IJ 2X1EA 3Q9VA 4YFXF 3A01A 3PL8A 5F1RA 2OCEA 4C2TA 4LJZF 1R5HA 3QU6A 2DYSH 3H3VK 3DKYA 2VT3A 3GF2A 1YIOA 2CUEA 2DCEA 2YU3A 4CCJA 3I53A 3ERED 3CCEI 4AM3A 4IZZA 1P9QC 5D5XB 1T0FA 1XGMA 5CQGA 1X3ZB 1R1TA 3CUOA 2NNNA 2KIQA 1WJFA 1VQ5I 2K86A 1OYIA 2ZCWA 4M3FA 2KDZA 4E7JA 2P4WA 3HTUA 2JZYA 4ZYDA 2GWRA 1MJBA 2CUJA 4A3GJ 2P81A 4G6QA 4G9YA 2XGCA 3L2RA 1YHQI 5DEQA
chains in the Genus database with same CATH topology
4A3IJ 2EZLA 2E2HJ 4Y7NJ 1ZR2A 3WHBA 2JA8J 5EYRA 2WB1N 4A93J 3HOXJ 3BQYA 1Y1VJ 4B1RA 1DU0A 1RKTA 4I76A 4XICA 2HOSA 1G2HA 3S1QJ 1NK2P 3IH4A 3VPRA 1MBEA 5EF6A 2E1OA 1X2NA 2LLKA 1JT6A 1EF4A 2E2JJ 3FKIJ 4GFBA 3K2AA 5IOYA 1OCPA 4M6VA 3I4NJ 2R92J 3JRAA 2RAEA 3GBGA 2HOTA 1ADNA 2GBYA 3PM1A 2R5YA 1RR7A 5JLWA 5IYBJ 2HDDA 4A3KJ 1K61A 3ZQCA 4DZPA 3NARA 3OSGA 1RESA 3FK6A 3JR9A 3MN2A 1I50J 4JP0A 2OF7A 5IYCJ 2LTPA 2LP0A 3SDGA 1JJ8C 3A03A 5GPAA 3Q3SA 3BTLA 2WAQN 1ZQ3P 4D7NA 1JKOC 1QRYA 4S0HB 2L7ZA 2XGEA 3G1MA 3HBLA 4A69C 4UUSA 4DW6A 1TC3C 2NVYJ 3FK7A 2GM4A 1MBFA 2DMUA 2X6OA 1JKQC 1F43A 2EH3A 1LFBA 1ZK8A 2I10A 3JRIA 1MSFC 2Y2ZA 2NOGA 3TEDA 5M5WJ 2DA5A 4A3LJ 4D5FA 2XSDC 1IUFA 4A3JJ 5FKKA 1AKHA 2L0KA 3CCYA 3RZOJ 4W97A 2CQQA 1JT0A 1MBJA 1ORKA 2HQ5A 1SFOJ 3GTQJ 3HGGA 1WI3A 1H89C 2K9QA 3JRGA 1CQTA 3S2DJ 5FKMA 1FTZA 4A3MJ 2VI6A 1WH7A 2WV1A 1YRNA 5M3FJ 1GVDA 4B4CA 1JUMA 1RPWA 2ECCA 3BTCA 3BR1A 2K40A 3S16J 1OJLA 1APLC 1VF9A 5IOZA 3TW7A 1S7EA 5EEAA 1BA5A 2QF7A 4MFEA 3D1NI 2H1KA 2R7ZJ 4QSHA 3BR0A 1GV5A 1B72B 2E19A 1FJLA 1I6HJ 1WH5A 4XRSG 2K9NA 2ECBA 3A02A 3BQZA 2O7OA 4Y52J 4X6AJ 1MSEC 2DMTA 3IH2A 3QQAA 2ID3A 2XB5A 2TCTA 4DYCA 2JA7J 3F0CA 1FIPA 2VPRA 2M9HA 4I6ZA 1OFCX 3BG3A 4JX5A 5GP9A 2XPWA 1MNMC 2L9RA 1AHDP 4M3DA 1BW6A 2VKVA 2CQXA 3HOUJ 4MIMA 2E2IJ 2DTZA 3TP3A 3CDLA 5F1JA 2M0CA 1TWCJ 1ETOA 1MBHA 2ELKA 3PO3J 2Y31A 2MW8A 4DZJA 3ZQGA 1UG2A 2DA2A 2IAIA 4MLOA 2ME0A 4JX6A 3HOYJ 2Y0SN 1UHSA 1VFCA 3E7LA 4V2GA 1Z77A 2X9DA 3S14J 1TWHJ 5EGOB 1JJ6C 2R0QC 2M34A 5GPCA 4MO7A 2ID6A 2JK3A 3LSRA 3SJMA 1GDTA 5HODA 2GLOA 1MH4A 2L7FP 3RKQA 3QPLA 2AO9A 9ANTA 3SFIA 3WHCA 1ZTRA 4CYCB 2FJ1A 5C4JJ 5EZHA 3BR6A 1GT0C 2LKXA 5BNGA 4NDLA 2DA1A 1IJWC 1ETWA 3I4MJ 5IYDJ 3JRFA 1JUSA 1PUFB 4M3BA 2HXIA 3FIWA 4B3AA 4HNVA 1BW5A 5F0HA 3HDDA 2XPUA 3ZOBA 3HOWJ 2M8GX 1IRZA 1UMQA 3OIOA 4BBRJ 2NVXJ 3UKGA 2IEKA 3BT9A 1WGXA 3HOVJ 3LOCA 5JLXA 2ME6A 2AHQA 3W6VA 4C3HJ 1GUUA 1BL0A 2HOAA 3MVPA 3DEWA 1QVTA 4XK4A 4BBSJ 3Q0UA 1HLVA 1IDZA 1LFUP 3JRHA 4JYKA 4BY1J 1POGA 3QPSA 3DCFA 3BG5A 1B72A 2XPVA 2QCOA 1OCTC 2H8RA 1ENHA 2CJJA 1A6IA 5J1YA 4FE4A 1AU7A 1T56A 1BJZA 1X58A 4FISA 1HOMA 2DMQA 5C4XJ 1ETVA 3TW6A 1ETKA 3JRCA 3O8GA 3GTJJ 2XRLA 4AC0A 1VNDA 3PO2J 2LFBA 2R93J 1D5YA 2HYJA 3L1PA 2YS9A 2FX0A 2G0EA 1W0TA 3LSGA 2JMWA 1T33A 2MGQA 2Y9ZA 2M2EA 1MH3A 4BXXJ 1FTTA 2FQ4A 2DN0A 1ITYA 1SANA 5IP9J 3OSFA 2K9SA 4ABZA 4X1EA 1IC8A 4FTHA 4L5EA 1FIAA 3HOZJ 3RZDJ 2N8GA 3HEFA 5F27A 4IHWA 2LD5A 3B6CA 3BR3A 3M3YJ 2DMPA 4G12A 3ZQIA 2EZIA 1I3QJ 1FEXA 5EGOA 5DS9A 3HGYA 3ZQFA 4DYRA 4C3JJ 3GTOJ 5M5YJ 3TP0A 5K7HA 4MFDA 3MKLA 5K7FA 4XRSA 1U9NA 5F04A 3IV5A 4A3CJ 5FLMJ 2W48A 4XRMA 2DA6A 5M3MJ 5EG0B 5C44J 1ZR4A 4BKXA 1IV6A 2HXOA 1H88C 3CQZJ 4QIWN 2NVTJ 2L7MP 4CYCA 5IP6A 5FJ8J 5J3LA 1R9TJ 3A01B 4AUXA 3JREA 3IH3A 2B63J 2XB0X 3GTGJ 2JA6J 2EZHA 3BTJA 2R5ZB 2DMNA 2DA7A 5F0FA 1PUFA 2LY9A 1Z0XA 4M3EA 5E3OA 3K7AJ 5EDNA 5FLVA 3S1NJ 1A5JA 3O8HA 2COBA 1DU6A 2LR8A 1RETA 2DA3A 1NK3P 2PMZN 5J1RA 1HDPA 1U9OA 2NVQJ 3LSPA 1XC5A 2DA4A 4FCYA 3G1LA 3LNQA 1B8IB 3S17J 1LE8B 3S1RJ 2X48A 4M3GA 1JTYA 1EYFA 1MBGA 4D7MA 1VI0A 4AYBN 5K7ZA 1O4XA 3C2BA 2KT0A 1JTXA 2Y30A 2VUMJ 3OOUA 3HB9A 1IGNA 4QTRA 3BTIA 3GTKJ 2MSYA 3JRDA 5FKOA 1E3OC 1WPKA 3H0GJ 1W0UA 2LVSA 1F36A 1P7IA 3LSJA 4W1UA 5FKLA 3JRBA 4A3FJ 1H8AC 3B6AA 3G1OA 4DYQA 4XIDA 2R5YB 1IG7A 2LK2A 3S2HJ 1NTCA 1QVUA 5EZGA 1ZGWA 4RBOA 5M5XJ 1HCRA 4IHYA 5E3NA 2MG4A 4V2FA 4EEFG 1Y1WJ 5E3LA 4BY7J 2JJ7A 3M4OJ 2JN6A 1WCMJ 1ETXA 3ZQHA 1U8BA 5DTDA 3GTPJ 5F0CA 1ZKGA 2IBDA 4LOCA 5FKNA 3GTMJ 2D5VA 1MBKA 2O9LA 1HDDC 1TWGJ 1TWAJ 4FE7A 2XGDA 1ETYA 1TWFJ 2EZKA 3FISA 1HF0A 1P7JA 2EBIA 2Y9YA 1Q1VA 4RDUA 4UUSB 1QPIA 1JUPA 1ETQA 4UUTA 3ZQLA 4A3DJ 1XS9A 3Q0VA 3Q0WA 2EQRA 2JWTA 3GTLJ 4J19A 3HKZN 1JKPC 2CRGA 2CUFA 3CMYA 2O8KA 1K83J 5IPAA 5E3MA 4C2MJ 5EG0A 1AKHB 3RQIA 1JGGA 1JKRC 4C3IJ 1RKWA 3A01A 2HI3A 4IHVA 3S1MJ 2ZB9A 1GV2A 4IHXA 3BR5A 5J1UA 3NAUA 2R5ZA 3H3VK 2DJNA 3BR2A 1U78A 2VKEA 3BG9A 2CUEA 4IEJA 1YRNB 2YU9J 2NS8A 3S15J 4A3BJ 2JA5J 1IDYA 4D5CA 3HM5A 4A3EJ 5F08A 2OPTA 2FD5A 2TRTA 4M3FA 2KDZA 2NS7A 4JX4A 1B8IA 1LE8A 2YUSA 5IP7J 4A3GJ 2P81A 2XGCA 5C3EJ 1X2MA 1XG1A 2CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I J;  2EZL A;  2E2H J;  4Y7N J;  1ZR2 A;  3WHB A;  2JA8 J;  5EYR A;  2WB1 N;  4A93 J;  3HOX J;  3BQY A;  1Y1V J;  4B1R A;  1DU0 A;  1RKT A;  4I76 A;  4XIC A;  2HOS A;  1G2H A;  3S1Q J;  1NK2 P;  3IH4 A;  3VPR A;  1MBE A;  5EF6 A;  2E1O A;  1X2N A;  2LLK A;  1JT6 A;  1EF4 A;  2E2J J;  3FKI J;  4GFB A;  3K2A A;  5IOY A;  1OCP A;  4M6V A;  3I4N J;  2R92 J;  3JRA A;  2RAE A;  3GBG A;  2HOT A;  1ADN A;  2GBY A;  3PM1 A;  2R5Y A;  1RR7 A;  5JLW A;  5IYB J;  2HDD A;  4A3K J;  1K61 A;  3ZQC A;  4DZP A;  3NAR A;  3OSG A;  1RES A;  3FK6 A;  3JR9 A;  3MN2 A;  1I50 J;  4JP0 A;  2OF7 A;  5IYC J;  2LTP A;  2LP0 A;  3SDG A;  1JJ8 C;  3A03 A;  5GPA A;  3Q3S A;  3BTL A;  2WAQ N;  1ZQ3 P;  4D7N A;  1JKO C;  1QRY A;  4S0H B;  2L7Z A;  2XGE A;  3G1M A;  3HBL A;  4A69 C;  4UUS A;  4DW6 A;  1TC3 C;  2NVY J;  3FK7 A;  2GM4 A;  1MBF A;  2DMU A;  2X6O A;  1JKQ C;  1F43 A;  2EH3 A;  1LFB A;  1ZK8 A;  2I10 A;  3JRI A;  1MSF C;  2Y2Z A;  2NOG A;  3TED A;  5M5W J;  2DA5 A;  4A3L J;  4D5F A;  2XSD C;  1IUF A;  4A3J J;  5FKK A;  1AKH A;  2L0K A;  3CCY A;  3RZO J;  4W97 A;  2CQQ A;  1JT0 A;  1MBJ A;  1ORK A;  2HQ5 A;  1SFO J;  3GTQ J;  3HGG A;  1WI3 A;  1H89 C;  2K9Q A;  3JRG A;  1CQT A;  3S2D J;  5FKM A;  1FTZ A;  4A3M J;  2VI6 A;  1WH7 A;  2WV1 A;  1YRN A;  5M3F J;  1GVD A;  4B4C A;  1JUM A;  1RPW A;  2ECC A;  3BTC A;  3BR1 A;  2K40 A;  3S16 J;  1OJL A;  1APL C;  1VF9 A;  5IOZ A;  3TW7 A;  1S7E A;  5EEA A;  1BA5 A;  2QF7 A;  4MFE A;  3D1N I;  2H1K A;  2R7Z J;  4QSH A;  3BR0 A;  1GV5 A;  1B72 B;  2E19 A;  1FJL A;  1I6H J;  1WH5 A;  4XRS G;  2K9N A;  2ECB A;  3A02 A;  3BQZ A;  2O7O A;  4Y52 J;  4X6A J;  1MSE C;  2DMT A;  3IH2 A;  3QQA A;  2ID3 A;  2XB5 A;  2TCT A;  4DYC A;  2JA7 J;  3F0C A;  1FIP A;  2VPR A;  2M9H A;  4I6Z A;  1OFC X;  3BG3 A;  4JX5 A;  5GP9 A;  2XPW A;  1MNM C;  2L9R A;  1AHD P;  4M3D A;  1BW6 A;  2VKV A;  2CQX A;  3HOU J;  4MIM A;  2E2I J;  2DTZ A;  3TP3 A;  3CDL A;  5F1J A;  2M0C A;  1TWC J;  1ETO A;  1MBH A;  2ELK A;  3PO3 J;  2Y31 A;  2MW8 A;  4DZJ A;  3ZQG A;  1UG2 A;  2DA2 A;  2IAI A;  4MLO A;  2ME0 A;  4JX6 A;  3HOY J;  2Y0S N;  1UHS A;  1VFC A;  3E7L A;  4V2G A;  1Z77 A;  2X9D A;  3S14 J;  1TWH J;  5EGO B;  1JJ6 C;  2R0Q C;  2M34 A;  5GPC A;  4MO7 A;  2ID6 A;  2JK3 A;  3LSR A;  3SJM A;  1GDT A;  5HOD A;  2GLO A;  1MH4 A;  2L7F P;  3RKQ A;  3QPL A;  2AO9 A;  9ANT A;  3SFI A;  3WHC A;  1ZTR A;  4CYC B;  2FJ1 A;  5C4J J;  5EZH A;  3BR6 A;  1GT0 C;  2LKX A;  5BNG A;  4NDL A;  2DA1 A;  1IJW C;  1ETW A;  3I4M J;  5IYD J;  3JRF A;  1JUS A;  1PUF B;  4M3B A;  2HXI A;  3FIW A;  4B3A A;  4HNV A;  1BW5 A;  5F0H A;  3HDD A;  2XPU A;  3ZOB A;  3HOW J;  2M8G X;  1IRZ A;  1UMQ A;  3OIO A;  4BBR J;  2NVX J;  3UKG A;  2IEK A;  3BT9 A;  1WGX A;  3HOV J;  3LOC A;  5JLX A;  2ME6 A;  2AHQ A;  3W6V A;  4C3H J;  1GUU A;  1BL0 A;  2HOA A;  3MVP A;  3DEW A;  1QVT A;  4XK4 A;  4BBS J;  3Q0U A;  1HLV A;  1IDZ A;  1LFU P;  3JRH A;  4JYK A;  4BY1 J;  1POG A;  3QPS A;  3DCF A;  3BG5 A;  1B72 A;  2XPV A;  2QCO A;  1OCT C;  2H8R A;  1ENH A;  2CJJ A;  1A6I A;  5J1Y A;  4FE4 A;  1AU7 A;  1T56 A;  1BJZ A;  1X58 A;  4FIS A;  1HOM A;  2DMQ A;  5C4X J;  1ETV A;  3TW6 A;  1ETK A;  3JRC A;  3O8G A;  3GTJ J;  2XRL A;  4AC0 A;  1VND A;  3PO2 J;  2LFB A;  2R93 J;  1D5Y A;  2HYJ A;  3L1P A;  2YS9 A;  2FX0 A;  2G0E A;  1W0T A;  3LSG A;  2JMW A;  1T33 A;  2MGQ A;  2Y9Z A;  2M2E A;  1MH3 A;  4BXX J;  1FTT A;  2FQ4 A;  2DN0 A;  1ITY A;  1SAN A;  5IP9 J;  3OSF A;  2K9S A;  4ABZ A;  4X1E A;  1IC8 A;  4FTH A;  4L5E A;  1FIA A;  3HOZ J;  3RZD J;  2N8G A;  3HEF A;  5F27 A;  4IHW A;  2LD5 A;  3B6C A;  3BR3 A;  3M3Y J;  2DMP A;  4G12 A;  3ZQI A;  2EZI A;  1I3Q J;  1FEX A;  5EGO A;  5DS9 A;  3HGY A;  3ZQF A;  4DYR A;  4C3J J;  3GTO J;  5M5Y J;  3TP0 A;  5K7H A;  4MFD A;  3MKL A;  5K7F A;  4XRS A;  1U9N A;  5F04 A;  3IV5 A;  4A3C J;  5FLM J;  2W48 A;  4XRM A;  2DA6 A;  5M3M J;  5EG0 B;  5C44 J;  1ZR4 A;  4BKX A;  1IV6 A;  2HXO A;  1H88 C;  3CQZ J;  4QIW N;  2NVT J;  2L7M P;  4CYC A;  5IP6 A;  5FJ8 J;  5J3L A;  1R9T J;  3A01 B;  4AUX A;  3JRE A;  3IH3 A;  2B63 J;  2XB0 X;  3GTG J;  2JA6 J;  2EZH A;  3BTJ A;  2R5Z B;  2DMN A;  2DA7 A;  5F0F A;  1PUF A;  2LY9 A;  1Z0X A;  4M3E A;  5E3O A;  3K7A J;  5EDN A;  5FLV A;  3S1N J;  1A5J A;  3O8H A;  2COB A;  1DU6 A;  2LR8 A;  1RET A;  2DA3 A;  1NK3 P;  2PMZ N;  5J1R A;  1HDP A;  1U9O A;  2NVQ J;  3LSP A;  1XC5 A;  2DA4 A;  4FCY A;  3G1L A;  3LNQ A;  1B8I B;  3S17 J;  1LE8 B;  3S1R J;  2X48 A;  4M3G A;  1JTY A;  1EYF A;  1MBG A;  4D7M A;  1VI0 A;  4AYB N;  5K7Z A;  1O4X A;  3C2B A;  2KT0 A;  1JTX A;  2Y30 A;  2VUM J;  3OOU A;  3HB9 A;  1IGN A;  4QTR A;  3BTI A;  3GTK J;  2MSY A;  3JRD A;  5FKO A;  1E3O C;  1WPK A;  3H0G J;  1W0U A;  2LVS A;  1F36 A;  1P7I A;  3LSJ A;  4W1U A;  5FKL A;  3JRB A;  4A3F J;  1H8A C;  3B6A A;  3G1O A;  4DYQ A;  4XID A;  2R5Y B;  1IG7 A;  2LK2 A;  3S2H J;  1NTC A;  1QVU A;  5EZG A;  1ZGW A;  4RBO A;  5M5X J;  1HCR A;  4IHY A;  5E3N A;  2MG4 A;  4V2F A;  4EEF G;  1Y1W J;  5E3L A;  4BY7 J;  2JJ7 A;  3M4O J;  2JN6 A;  1WCM J;  1ETX A;  3ZQH A;  1U8B A;  5DTD A;  3GTP J;  5F0C A;  1ZKG A;  2IBD A;  4LOC A;  5FKN A;  3GTM J;  2D5V A;  1MBK A;  2O9L A;  1HDD C;  1TWG J;  1TWA J;  4FE7 A;  2XGD A;  1ETY A;  1TWF J;  2EZK A;  3FIS A;  1HF0 A;  1P7J A;  2EBI A;  2Y9Y A;  1Q1V A;  4RDU A;  4UUS B;  1QPI A;  1JUP A;  1ETQ A;  4UUT A;  3ZQL A;  4A3D J;  1XS9 A;  3Q0V A;  3Q0W A;  2EQR A;  2JWT A;  3GTL J;  4J19 A;  3HKZ N;  1JKP C;  2CRG A;  2CUF A;  3CMY A;  2O8K A;  1K83 J;  5IPA A;  5E3M A;  4C2M J;  5EG0 A;  1AKH B;  3RQI A;  1JGG A;  1JKR C;  4C3I J;  1RKW A;  3A01 A;  2HI3 A;  4IHV A;  3S1M J;  2ZB9 A;  1GV2 A;  4IHX A;  3BR5 A;  5J1U A;  3NAU A;  2R5Z A;  3H3V K;  2DJN A;  3BR2 A;  1U78 A;  2VKE A;  3BG9 A;  2CUE A;  4IEJ A;  1YRN B;  2YU9 J;  2NS8 A;  3S15 J;  4A3B J;  2JA5 J;  1IDY A;  4D5C A;  3HM5 A;  4A3E J;  5F08 A;  2OPT A;  2FD5 A;  2TRT A;  4M3F A;  2KDZ A;  2NS7 A;  4JX4 A;  1B8I A;  1LE8 A;  2YUS A;  5IP7 J;  4A3G J;  2P81 A;  2XGC A;  5C3E J;  1X2M A;  1XG1 A;  2CU7 A; 
#chains in the Genus database with same CATH topology
 2HDW A;  1OQY A;  3QOE A;  4E7I A;  1ZR2 A;  3DPT A;  3WHB A;  2WB1 N;  5CYV A;  2GAU A;  2WV0 A;  1A04 A;  3I59 A;  2HZD A;  2M30 A;  1VTN C;  3GFM A;  4KA4 A;  4F93 B;  1X3U A;  2WY7 Q;  3ZXS A;  1XB4 A;  1WJE A;  3BG6 A;  2O0Y A;  3M8E A;  1MBE A;  1Z1D A;  1WWX A;  4KIC A;  3RPU D;  3VPR A;  4IHT A;  3HPH A;  1J5Y A;  1PP7 U;  4IJA A;  2UZK A;  1OCP A;  3I4N J;  2VE8 A;  1F4K A;  3K0L A;  2RAE A;  2QVO A;  2WAF A;  1XMA A;  3I4P A;  2HOT A;  2GBY A;  5JLW A;  1RI7 A;  2HDD A;  4UHT A;  5F64 A;  1K61 A;  2BYV E;  5GAE J;  2HYF A;  3DLL F;  3A0H C;  5CKT A;  1OLT A;  2OV7 A;  1FBU A;  4JP0 A;  1UEL B;  2F4I A;  1PVE A;  2RNG A;  4WXC A;  5GPA A;  3Q3S A;  3QYF A;  5K5R A;  2QA4 I;  3FF5 A;  5F6F A;  1IV8 A;  1N25 A;  3BTL A;  1ZQ3 P;  4P55 A;  1XN7 A;  4D7N A;  3DKW A;  1U5T A;  3DV8 A;  1JKO C;  1QRY A;  2P7C B;  3CME I;  2XV4 S;  2AS5 F;  2IA1 A;  1J9I A;  1IN6 A;  1PYV A;  2H94 A;  2HKX A;  1UZC A;  5J4V A;  1KQ9 A;  4XQF A;  3OMY A;  1IN8 A;  2ICW G;  3FM5 A;  1JKQ C;  2W57 A;  3K1P A;  4F91 B;  2HS5 A;  5DUK A;  4GXO A;  1TW3 A;  4RAF A;  1FYK A;  3V8L A;  5FGM A;  4ZJZ A;  2M4K A;  4BQN A;  1SMY F;  2H09 A;  5DYM A;  3CCY A;  4BJT A;  4B44 A;  2VOP A;  1E3H A;  2CQQ A;  2JUG A;  1MBJ A;  1ORK A;  2HQ5 A;  2HNH A;  4FT8 A;  2M1B A;  3P9K A;  3J81 K;  1WI3 A;  3GTQ J;  1VQO I;  1AA7 A;  3HL2 A;  5FKM A;  2WV1 A;  4BAC A;  1S72 I;  4YEL A;  1I27 A;  2XAH A;  1GVD A;  3MFK A;  2X6Y A;  4IQ4 A;  1I3A A;  4Q47 A;  1TTY A;  2Q2E A;  3BTC A;  4ITV A;  3COA C;  4XN3 A;  3TO9 A;  3TDZ C;  4CCK A;  1I1S A;  1APL C;  3ASN H;  3EUK L;  5IOZ A;  4OIO F;  1TT5 B;  1AWC A;  2QF7 A;  4IRG A;  3D1N I;  2R7Z J;  4IL6 C;  2VOO A;  1BM9 A;  3LST A;  2E19 A;  2VC1 A;  1Y6I A;  5CVI A;  1BI1 A;  1R49 A;  1ZLK A;  3T0Y A;  3DFG A;  4XR6 A;  1G4D A;  4BHC A;  4X6A J;  3AG1 H;  2DMT A;  2FQ3 A;  1V3F A;  2V9V A;  2FRH A;  3KFW X;  2XB5 A;  1IN4 A;  2BVM A;  2VPR A;  2ZME C;  3LL7 A;  2X0L A;  2A07 F;  3O2P E;  4A2U A;  3BG3 A;  4JX5 A;  4I6Z A;  3SFZ A;  3ZQQ A;  5GP9 A;  5GTI C;  3CUQ A;  1AHD P;  4M3D A;  2EIL H;  5IT3 A;  3Q5F A;  1YFH A;  2VKV A;  1VQM I;  3HOU J;  1S3J A;  1R5G A;  3HG9 A;  2E7W A;  4F3Q A;  2KIM A;  1JI8 A;  3CJT B;  4KIB A;  2DO7 A;  4Q4Z F;  3L2V A;  4DZJ A;  2KFD A;  4LB6 B;  3ZQG A;  4DOZ A;  3MCZ A;  2C6Y A;  4MLO A;  1QO0 D;  2RQP A;  3NQO A;  1TL8 A;  1OCR H;  2Y0S N;  3TO7 A;  4MEY F;  2E36 A;  2KL4 A;  4P9U A;  3BC8 A;  3S14 J;  1TWH J;  1LEA A;  2XRO A;  5EGO B;  4CCM A;  5GPC A;  1KU9 A;  2P5V A;  2R7U A;  1FT9 A;  2P6T A;  4WCG A;  4FET A;  2MFZ A;  2JK3 A;  3JW4 A;  1X1D A;  4S04 A;  1YYV A;  1MH4 A;  1SMT A;  5DV5 A;  2IS6 A;  2CQ7 A;  1PDN C;  1BOB A;  2STT A;  4P9F A;  4LG3 A;  1R58 A;  1OYY A;  3NWT A;  5EZH A;  4YFN F;  1FX7 A;  3KP3 A;  1FY7 A;  5AON A;  3PIP F;  4A0X A;  3DTI A;  2L01 A;  2VBW A;  4HDU A;  1G3W A;  3IP4 B;  3JRF A;  1YO5 C;  2BHZ A;  2R4G A;  1W5T A;  2ESH A;  1PUF B;  4HDV A;  3P9I A;  4LIU A;  3QU3 A;  3WTS C;  3F8F A;  1BW5 A;  3HDD A;  3F9K A;  1S29 A;  4BH9 A;  2KHM A;  3U9G A;  2BE5 F;  1O7L A;  3OV8 A;  1XCB A;  3REO A;  4BUP A;  4OOI A;  4WF2 A;  3ZMZ A;  1HC8 A;  1UB9 A;  3OIO A;  1K78 B;  4BBR J;  3UKG A;  2PI0 A;  3SZG A;  1WGX A;  1D1B A;  3LQQ A;  3LOC A;  4KFC A;  2HPI A;  3A2K A;  2MAB A;  5K5Q A;  4BE2 A;  1SAX A;  4NUB A;  1BL0 A;  4ANJ A;  3MVP A;  1Z21 A;  3MZY A;  1T38 A;  4XK4 A;  2FEZ A;  2JVG A;  1QHH D;  2GOX B;  3S2W A;  4Z2Y A;  2Z3Y A;  4G7H F;  5E1X A;  4JYK A;  1K79 A;  2W24 A;  3R60 A;  2QCO A;  3GFI A;  3MZH A;  3T5X A;  1XDS A;  1ENH A;  2CJJ A;  2XGX A;  4BHP A;  4KN4 X;  3GFL A;  1PJR A;  4AIH A;  5TJJ A;  4DGW B;  1T56 A;  1OCZ H;  3GFJ A;  3I71 A;  3OYM A;  1HOM A;  1HSJ A;  2FMY A;  4BGD A;  2W4S A;  2PFB A;  1VQL I;  1QQI A;  1ETK A;  4A5N A;  1FMW A;  4G7O F;  3BZC A;  3O8G A;  4K2E A;  4NC7 A;  3J7Z I;  2XRL A;  4AC0 A;  1MND A;  1T95 A;  1K6O A;  4HYE A;  1UST A;  1EH8 A;  3KET A;  3EYY A;  3L2U A;  3QP6 A;  4I99 C;  3FXJ A;  2LY2 A;  3V7C A;  2HYJ A;  5D8L B;  1S5L C;  1HW2 A;  1A6Q A;  3M1E A;  5HLT A;  1RIO H;  4AVZ A;  2E34 A;  2KKO A;  5H6Q A;  1MH3 A;  5K1Y A;  5HNF A;  1GXP A;  2R7O A;  1ITY A;  1GLN A;  2CW8 A;  5D5V B;  5IP9 J;  4MGR A;  1E2X A;  3GLL A;  5E20 A;  3R6S A;  1EA3 A;  2EV6 A;  2WAQ A;  1YX3 A;  1I3Q J;  4MNU A;  3FXQ A;  5DS9 A;  2J5P A;  2EWN A;  2ACJ A;  1Y0U A;  3IV5 A;  4N0B A;  4KMF A;  2DA6 A;  2EFW A;  1U6G A;  5BMZ A;  1Z3Y A;  2MC4 A;  2DFF A;  3H92 A;  2VXZ A;  3P7N A;  4ZTJ A;  5IP6 A;  1R9T J;  1XSV A;  3A01 B;  4OMY A;  3IL2 A;  3TKY A;  3JRE A;  2B63 J;  1B6A A;  1R1V A;  2XB0 X;  1W36 C;  2JA6 J;  4H4K C;  2FML A;  2HFH A;  2LY9 A;  4N4O B;  2JRM A;  3K7A J;  4RAY A;  5EDN A;  3WU1 B;  3CO6 C;  2H6B A;  3CF5 F;  1NK3 P;  2JT1 A;  3TGN A;  2F4O B;  1HDP A;  3CCS I;  4XLN F;  1QU3 A;  4A6E A;  1XC5 A;  4LIV A;  4WXH A;  3S1R J;  2X48 A;  3CJN A;  1JTY A;  1WJD A;  4CCL A;  1VI0 A;  1WQ2 A;  2VL8 A;  3OOP A;  1R22 A;  1W5S A;  4AYB N;  2KRH A;  1O4X A;  2W82 A;  3C2B A;  3G4S I;  4IOA F;  3T8R A;  2HU9 A;  1IXR C;  3ZMU A;  3WGG A;  4I0B A;  2KJB A;  3OOU A;  3I59 B;  2CQN A;  2QBY A;  1IGN A;  1K7A A;  2CG4 A;  3PUF A;  1XSX A;  5E1W A;  4E4H A;  2EIN H;  4EM1 A;  5HDN A;  1F36 A;  4XBF A;  3LA7 A;  4A3F J;  1H8A C;  3OYE A;  2BXY A;  2R7Q A;  4EJO A;  2HZT A;  3C18 A;  4DYQ A;  2QM3 A;  3EDP A;  3H3U A;  2GXB A;  4XID A;  1N75 A;  1D8K A;  3GWZ A;  3MZ8 A;  2ZJR F;  1LVK A;  5JR3 A;  2OD5 A;  5M5X J;  3W2V A;  2Z2S B;  1LNW A;  3VYS B;  2XKO A;  1DDN A;  1YLF A;  2FU4 A;  4M9X A;  3M4O J;  3O3K A;  3GEZ A;  2EA4 A;  3OYB A;  2UUZ A;  5F0C A;  1JE8 A;  2JPC A;  4LOC A;  2R7T A;  3GTM J;  2BZT A;  4HOB A;  3OY9 A;  2NNY A;  2D5V A;  1D0Y A;  1F9N A;  1J59 A;  1U5T B;  3PSI A;  2EZK A;  3KYC B;  3OWT A;  4HG2 A;  1L3L A;  3GW2 A;  2EBI A;  3OS2 A;  1Z9C A;  3BOQ A;  3K4B A;  1SD6 A;  2V4J C;  4G94 A;  4L0Y B;  3T8T A;  2E1N A;  1Q1V A;  1O7F A;  3OYI A;  4O3M A;  3E0J B;  2WC2 A;  3JCU C;  3K4N A;  3BJO A;  3ZQL A;  1I6X A;  3ZN0 A;  4II2 A;  4J19 A;  4DNC A;  4BNC A;  2Y48 A;  2VKH A;  3L00 A;  2M8E A;  1W7P D;  3FHN A;  4TV7 A;  3MKY B;  2CUF A;  3F8N A;  2PMZ A;  2O8K A;  3CD6 I;  4EQQ A;  2B7E A;  5EG0 A;  3QPH A;  5J47 A;  3MAJ A;  4RMN A;  2DT7 B;  4E70 A;  1X4O A;  2OQR A;  1RKW A;  4IHV A;  3S1M J;  4M72 A;  4ZH4 F;  2HPM A;  1MGT A;  1RUO A;  3WTU C;  2V6C A;  1ZN2 A;  3BR5 A;  1K4T A;  5J1U A;  3NAU A;  2R5Z A;  3M1C A;  3BR2 A;  4ZTF A;  2VKE A;  3MKW B;  5E18 F;  3HSF A;  2NS8 A;  4A3B J;  2QYO A;  2Q2E B;  1TNT A;  3GME A;  4RB3 C;  4L5I A;  5LRS A;  3EUA A;  2K4B A;  1LB2 A;  1HW5 A;  2P8T A;  5F08 A;  2OPT A;  2FD5 A;  2PEX A;  2TRT A;  4CIC A;  4JX4 A;  1LDJ A;  1B8I A;  1LE8 A;  2R7V A;  2G7U A;  3O6B B;  2YUS A;  1X3W B;  5C3E J;  1P4A A;  2GIV A;  5LLQ A;  2O6G E;  1ZYR F;  3PJR A;  2LSO A;  2BBY A;  2L02 A;  4KUM A;  2MLG A;  3EYI A;  4Y7N J;  3AAF A;  1OPC A;  4II3 A;  1USS A;  2X6W A;  4ZYH A;  3FXK A;  4BJ6 C;  3S3M A;  4UXN A;  2OQG A;  5D4S A;  4A93 J;  1T8I A;  2ZNY A;  3RTR A;  1Y1V J;  3MMY B;  3K9T A;  3LA3 A;  1WSU A;  3H0D A;  4RGX A;  3E6D A;  1B59 A;  4HF0 A;  1NK2 P;  3IH4 A;  1VQK I;  1VQ8 I;  1K6Y A;  3HRT A;  2ZFW A;  1I5Z A;  5EF6 A;  4RGU A;  1X2N A;  1K78 A;  2LLK A;  1JT6 A;  3FKI J;  2VE9 A;  1T0F C;  5IOY A;  4BQO A;  3CO7 C;  4M6V A;  2EFO A;  4BL0 B;  3JRA A;  1V5G A;  1YIJ I;  4IXA A;  3GO5 A;  3PM1 A;  5CVJ A;  1VQ6 I;  4A3K J;  3ZQC A;  2F5D A;  3OSG A;  4ZYA A;  1I50 J;  1D1A A;  3DP7 A;  3CCL I;  2X4H A;  2YR2 A;  2LP0 A;  2QLZ A;  3SDG A;  4ZYG A;  2D45 A;  3F6O A;  4UNO A;  4ZC3 A;  2A5W A;  3B73 A;  3IC7 A;  2ADU A;  5LBQ A;  3CC7 I;  2ISY A;  1KU7 A;  3V7R A;  1T6S A;  3LSM A;  5LFA A;  1UHW A;  2W00 A;  1MNE A;  2E1M C;  2IGN A;  3HBL A;  4YII A;  4A69 C;  1P4X A;  1O3T A;  2ZXI A;  2RN7 A;  3H35 A;  4Q48 A;  4U0W A;  5ICG A;  3F8B A;  3M07 A;  3FK7 A;  3H36 A;  2DMU A;  4PFP A;  4N9I A;  1ZK8 A;  2I10 A;  1MSF C;  2HGC A;  1SD5 A;  3VOD A;  2DFI A;  2ELH A;  2H1L A;  1S9H A;  1YE9 A;  5HLG A;  1QGP A;  3FWE A;  3C2G A;  3SXY A;  2L54 A;  3R0A A;  2IGK A;  3RZO J;  2M3A A;  3KP2 A;  3ZRG A;  3PQJ A;  1MMN A;  4PJM A;  4OIP F;  1SFO J;  3HGG A;  1H89 C;  2F5V A;  2ZSH B;  3D5R C;  3HJE A;  5CQE A;  3JRG A;  1XD7 A;  4UB8 C;  4O6J A;  4PJJ A;  1DGR M;  3A1Y A;  1FPQ A;  4A3M J;  1ZRD A;  1QPM A;  5LGN A;  4CXF A;  1JGS A;  2QKM B;  2P7V B;  4OAZ A;  1CF7 A;  5ICC A;  1YRN A;  1OCC H;  3KEQ A;  4R8H A;  5M3F J;  1RPW A;  2ELJ A;  2LYC A;  4B43 A;  5CVR A;  4OIN F;  2WBM A;  2FOW A;  4H0E A;  4CH7 A;  4WWC A;  3ZMT A;  1OJL A;  1VF9 A;  1IXC A;  2X51 A;  4IOC F;  4NQW A;  1S7E A;  3HSR A;  1Z7L A;  5CVV A;  2PLY A;  2M45 A;  2Z5U A;  1S6L A;  4UY8 I;  1SAU A;  4OWR B;  3JTG A;  1ZAR A;  4HX4 A;  5DM6 F;  4OU0 A;  1I6H J;  3J80 Z;  2L3D A;  4PGG A;  4MHG A;  1A35 A;  2ECB A;  2OJE D;  1E3P A;  3KP7 A;  5FLX K;  1D5V A;  3BQZ A;  5D6F A;  2CO5 A;  3FHZ A;  4Y52 J;  2OZ6 A;  2BY0 A;  3L2C A;  2EV0 A;  4HX8 A;  2ID3 A;  2JPB A;  3WG9 A;  1ZLJ A;  2TCT A;  4JK1 X;  1G59 A;  3F0C A;  4BYY A;  2M9H A;  3FXL A;  1BI0 A;  2EJR A;  3MQ0 A;  2XPW A;  3VYT B;  2DPU A;  3RCO A;  2QZ8 A;  2Z9O A;  2E2I J;  2DTZ A;  3CDL A;  1TQP A;  4PJL A;  2IS4 A;  3CCR I;  1RC9 A;  4F7Z A;  1X1C A;  1W36 D;  2VIX A;  2KLO A;  2BW3 A;  2MW8 A;  1LUJ B;  3KZZ A;  1DPU A;  2L9S A;  1ZG1 A;  3TDU C;  5D5U B;  4JX6 A;  3HOY J;  4E7Z A;  5L3G A;  1MZB A;  3E7L A;  1TW2 A;  3U21 A;  2IA2 A;  2DPD A;  2R0Q C;  2M34 A;  2XIG A;  3CMM A;  3OYF A;  4ON0 A;  3LSR A;  3SJM A;  2GLO A;  2BY2 A;  2XAU A;  1OYW A;  2K02 A;  1Y0N A;  1FC3 A;  3CUQ C;  4BU2 A;  1MDM A;  3RKQ A;  3QPL A;  3E5X A;  2QQ9 A;  3WHC A;  5FRM A;  4CSW A;  4U7D A;  2JUC A;  4C9Y A;  3HZJ A;  4RGS A;  1GT0 C;  2LKX A;  5BNG A;  5E8G A;  2B9S A;  2V7F A;  1ETW A;  3I4M J;  3HRM A;  1IRG A;  4HEA 2;  1H9T A;  3GZN B;  1U8R A;  2HXI A;  2KIF A;  1RR8 C;  5FFZ A;  4B3A A;  2PBI A;  5B3S H;  3WGH A;  4G7Z F;  2XPU A;  2BY3 A;  3BG7 A;  2VXD A;  1XSD A;  1JHF A;  3OR2 C;  1MMD A;  3WGI A;  3F3X A;  5HDG A;  4XLC A;  1GVJ A;  2XF7 A;  2IEK A;  1YIT I;  2HQN A;  3K1N A;  3ZMD A;  2PJP A;  3K4C A;  1T08 B;  2AQE A;  2IVM A;  2CUZ A;  4HA8 A;  2AHQ A;  3DU5 A;  3K10 A;  4D0P A;  2TDX A;  4C3H J;  5HNH A;  3GYH X;  3TL4 X;  1TNS A;  3CP8 A;  3Q0U A;  1ZG3 A;  2K27 A;  4E6K G;  1HLV A;  2QBY B;  2K4J A;  4BY1 J;  3JRH A;  3G71 I;  4CA0 A;  1POG A;  5GTH C;  4HRI A;  3DCF A;  1R23 A;  2H6C A;  2H8R A;  2A5Y B;  2K5C A;  3SEZ A;  2AXL A;  3BLY A;  4XL9 A;  1A6I A;  1D3Y A;  4MEX F;  4HQE A;  2KRF A;  4HSR A;  4DIQ A;  1G3Y A;  4HX7 A;  3I5U A;  3FXO A;  1X58 A;  1XGO A;  2DBB A;  5HS9 A;  3H1C A;  3MWM A;  3ABL H;  2A05 A;  2NRA C;  5ERI A;  1ZRE A;  2L5Q A;  3GTJ J;  1SFU A;  3FDY A;  3OS1 A;  3ERM A;  2LDU A;  2LFB A;  4RGR A;  3QP5 A;  3OL3 A;  4XRF A;  2R93 J;  2O61 A;  4YG2 F;  3IHU A;  3LMM A;  1DP3 A;  2KJC A;  1Z6T A;  2KRC A;  4EAT A;  4EGY A;  3QPT A;  3EQL F;  3IRR A;  2FX0 A;  3DTE A;  2G0E A;  2K9L A;  2EB7 A;  2CFX A;  3LSG A;  4AD9 A;  1W0T A;  2RRE A;  1CGP A;  2RKH A;  2G7H A;  3HYI A;  1Q1H A;  2L2O A;  1YI2 I;  3RDI A;  1XPX A;  1SAN A;  2E60 A;  3JTH A;  3OSF A;  2DOF A;  1LFP A;  4ABZ A;  4E7K A;  5AIQ A;  3LAP A;  3PUB A;  1D0Z A;  4FTH A;  4L5E A;  1FIA A;  2QQB A;  3RZD J;  2N8G A;  3J80 K;  3ELK A;  1ZGA A;  4GO1 A;  1HKT A;  2CS3 A;  2EZI A;  4ZDO A;  1FEX A;  2DW4 A;  3HGY A;  2MA3 A;  2NS0 A;  4C3J J;  2LOO A;  3VOE A;  5K7F A;  4IF4 A;  4A3C J;  2F5E A;  4IRH A;  2VN2 A;  2JSP A;  5FLM J;  2W48 A;  1J7K A;  2CFO A;  5EG0 B;  4MTD A;  2HTS A;  1IV6 A;  2HXO A;  4ZYE A;  4QIW N;  2NVT J;  2MLK A;  1RRJ A;  3M9A A;  1O57 A;  4AUX A;  4DQ2 A;  3PQK A;  3GTG J;  4BE0 A;  4ESB A;  3WTT C;  2MH9 A;  1YJN I;  3BTJ A;  3KYD B;  2R5Z B;  2WAE A;  2XAS A;  5E3O A;  1I1G A;  1REP C;  5FLV A;  3PFI A;  4NBQ A;  1A5J A;  2DYR H;  1DU6 A;  3AL0 B;  1X19 A;  1U9O A;  1ZHF A;  2V9K A;  3LSP A;  4FCY A;  5J6X A;  1B8I B;  3S17 J;  1LE8 B;  3K70 C;  1DUX C;  4QPO A;  1MMA A;  1MBG A;  4M6X A;  1WJB A;  1YW8 A;  1SVM A;  4D7M A;  3LQR A;  3RYR A;  3D5S C;  1BN5 A;  1IO2 A;  2PMH A;  3TO6 A;  4L18 B;  2Y30 A;  2VUM J;  4YRV A;  1KON A;  2E35 A;  3DXJ F;  2KMU A;  3PIO F;  3HB9 A;  3CCJ I;  3KYL A;  4F52 A;  4B48 A;  5KCM A;  3OYJ A;  3BTI A;  3JSP A;  2CGP A;  3GTK J;  4NB5 A;  5EEH A;  1VQP I;  3W2W A;  5L3F A;  3HC7 A;  2DT6 A;  2FA5 A;  3PNY A;  5FKO A;  2PN6 A;  3E5Q A;  4KIT B;  1T39 A;  1E0E A;  2CW7 A;  2VJJ A;  3JRB A;  3QOD A;  4U87 A;  1FOY A;  1MW7 A;  1Z7U A;  3KPH A;  3DBL B;  3DF8 A;  3K2Z A;  3BDD A;  1IG7 A;  2KZG A;  1ON2 A;  1O3R A;  1M1E B;  5A2Q Z;  2KIU A;  1LDK B;  4IHY A;  2R7D A;  2P5L C;  3LFU A;  5LEJ A;  3VFZ A;  2LKS A;  3BP8 A;  4OIR F;  1Y1W J;  5E3L A;  4DBQ A;  3TBI A;  4Y4R A;  3ULQ B;  2FUG 2;  1WCM J;  4KJZ A;  3OYN A;  2VQH A;  1G3T A;  2NYX A;  2RGV A;  1ETX A;  3ZQH A;  1U8B A;  5DTD A;  1V54 H;  2LKP A;  4YIR X;  2M5W A;  1W7P A;  3DKX A;  4IKF A;  2O9L A;  1OR7 A;  3QAH A;  4EV0 A;  3SEQ A;  3NRV A;  4C30 A;  1ETY A;  4FHT A;  4NC6 A;  3WU2 C;  1XCV A;  4CZC A;  2DI3 A;  1ZH5 A;  3IRQ A;  2Y9Y A;  2VAS A;  3HOT A;  2EV5 A;  1QPI A;  4RDU A;  4UUV A;  2LMD A;  4XLF A;  1XS9 A;  3Q0W A;  2EQR A;  3V7S A;  1Z3X A;  2X6X A;  3FXM A;  1TLH B;  4AIK A;  4HLY A;  2V9P A;  3BJA A;  1K83 J;  5E3M A;  1FZP B;  5D4R A;  3OL4 A;  5B1B H;  1IF1 A;  5IY5 H;  3VSL A;  3M8J A;  5DD8 A;  3G73 A;  4BS9 A;  2YX4 A;  4B47 A;  1Y39 A;  2HI3 A;  2ZB9 A;  4I09 A;  4KIS A;  2L4M A;  1DQU A;  1SVL A;  2X1C A;  3GZ5 A;  4ENN A;  4EMS A;  1DPR A;  1VZ0 A;  5LHI A;  2CSO A;  2DJN A;  2ZJ2 A;  1CF7 B;  1YRN B;  3K4J A;  3CDI A;  1W5C C;  2QWW A;  4HLX A;  3S15 J;  3CES A;  1ZRF A;  4XMY A;  1IDY A;  3IWF A;  4UV8 A;  3D0S A;  3E6M A;  4LLG F;  3HM5 A;  1KYW A;  4A3E J;  4CCO A;  4NQW B;  4EGZ A;  1KYZ A;  2NS7 A;  2Y0M A;  2HOE A;  5IP7 J;  1TQI A;  4A0Y A;  3M7G A;  2BVL A;  1X2M A;  2L9N A;  1MD0 A;  4JOM A;  2RNJ A;  3J7Y J;  3FMS A;  2CU7 A;  1U3E M;  4A3I J;  2XAG A;  2EZL A;  2E2H J;  4IVN A;  2F5F A;  3KE2 A;  2HVS A;  2JA8 J;  5EYR A;  1P4W A;  2MBF A;  2GOM A;  2KDO A;  3KP5 A;  3QOP A;  1F5T A;  3BQY A;  3FM3 A;  4WK8 F;  1DU0 A;  1G2H A;  2GA2 A;  2R7W A;  2A69 F;  1TZL A;  3S1Q J;  1ERD A;  3RYP A;  1OCO H;  1QHG A;  1WFX A;  4RB1 A;  2FE3 A;  1FP1 D;  3OIQ A;  5FO5 A;  1YW9 A;  4GFB A;  2XRN A;  4A5M A;  1FSH A;  2R92 J;  4WXD A;  1RNL A;  3GBG A;  1ADN A;  5HS7 A;  2R5Y A;  1RR7 A;  1J75 A;  5IYB J;  1BI2 A;  1F1Z A;  3DTK A;  3LSK A;  4DZP A;  1E17 A;  1FP2 A;  2BW3 B;  4A0Z A;  3JR9 A;  3MN2 A;  4Y17 A;  2HR3 A;  5J4Y A;  3IWZ A;  3KEO A;  3DPL C;  1B1B A;  2EPF A;  5L3B A;  5IYC J;  3L2Q A;  2BV6 A;  4M71 A;  1JJ8 C;  3A03 A;  4PFO A;  4Z6Y A;  4EM2 A;  2EK5 A;  1KQ8 A;  2P6S A;  3FKJ A;  2XVC A;  2WAQ N;  2VKD A;  1RZ4 A;  4S0H B;  2CV1 A;  2L7Z A;  4QLC U;  1FYL A;  2RC4 A;  1Z05 A;  4QWQ A;  3HRS A;  4BDY A;  3G1M A;  4V19 K;  3H3Z A;  4G8X A;  5GAH J;  1MDM B;  1YJ9 I;  2VLA A;  1RUN A;  1Z91 A;  4UUS A;  3P9C A;  4DW6 A;  1N77 A;  2GM4 A;  4HPQ A;  4NNJ A;  2ZXH A;  3RPQ A;  4JBA A;  1IZ1 A;  1XGN A;  2EH3 A;  1HA8 A;  2A68 F;  1LFB A;  3KX2 A;  3JRI A;  2K3F A;  2NOG A;  3ISP A;  3ABT A;  3WU0 A;  4BJ5 C;  2WAD A;  5E79 C;  2OC6 A;  4U7B A;  4D5F A;  2AQF A;  1IUF A;  3RKW A;  3H5A A;  2X1D A;  5BPI A;  5FKK A;  4ESJ A;  5A2Q K;  1W1W E;  2EIJ H;  2L0K A;  2F48 A;  1P6R A;  4HV5 A;  2ZSI B;  1JT0 A;  2FF4 A;  2BOL A;  4Y15 A;  2PMU A;  2M7A A;  1S8N A;  2E5N A;  2WA0 A;  3OS0 A;  3MEX A;  3AKZ A;  2P5K A;  1FTZ A;  3ABM H;  1WHU A;  4RAZ A;  1UJ8 A;  4XN0 A;  5BOX A;  4QPQ A;  2XSJ C;  5L3D A;  1V5E A;  3WTZ A;  2IRF G;  4M73 A;  1NG6 A;  2ECC A;  4B4C A;  4LLN A;  2YPR A;  5DD4 A;  3CLO A;  3BR1 A;  2K40 A;  2Z99 A;  3DWL E;  2FBK A;  2NXN B;  3R61 A;  3TW7 A;  2COM A;  3RQ4 A;  1BA5 A;  2AXT C;  1XMK A;  4MFE A;  4QSH A;  2FSW A;  4HQM A;  1R4N B;  1ZEL A;  4PSW A;  1LEB A;  1WH5 A;  2BGC A;  4YFK F;  3I56 I;  1WVR A;  4XRS G;  1A31 A;  2K9N A;  3DPU A;  2HWV A;  3K69 A;  3BZK A;  2L7K A;  2QSH X;  2J5O A;  2E71 A;  4RM2 A;  2KZV A;  1MSE C;  2QGU A;  3BPX A;  3IH2 A;  2DDA A;  4N4N B;  1KU2 A;  4CO8 A;  4DYC A;  3TQN A;  3RPU A;  3ABU A;  4XLE A;  4B09 A;  1OFC X;  3PFY A;  2VQL A;  2D2W A;  3FMQ A;  2MD5 A;  2KP6 A;  4RLF A;  4CYD A;  4EJT A;  2VON A;  2L9R A;  1BC8 C;  4MIM A;  2M4G A;  3ZP5 A;  3S93 A;  2V1X A;  5H2F C;  4HF2 A;  3L9F A;  2DT5 A;  2LH9 A;  3SDB A;  2ZC2 A;  4BQA A;  3FMR A;  1TWC J;  3W6K B;  2ELK A;  2KQR A;  2O03 A;  2XAF A;  2Y31 A;  2FBH A;  2V79 A;  2HYG D;  1XGS A;  2IAI A;  5LGT A;  2ME0 A;  3FXR A;  4EVI A;  3VWB A;  2JSC A;  5LD2 C;  2ZJQ F;  2Y75 A;  2A3S A;  1T98 A;  3CP2 A;  1SFK A;  1LKX A;  3P5J A;  5AIP A;  4GCV A;  4V2G A;  5BS6 A;  2Z1D A;  3FBN B;  2DDB A;  2DXI A;  3K70 D;  1JJ6 C;  1HKQ A;  1MJ9 A;  2ID6 A;  4ENM A;  1GDT A;  5HOD A;  1XX5 A;  2DOD A;  4CUG A;  3F6V A;  4XNF A;  3HHH A;  2AO9 A;  9ANT A;  3AG3 H;  4BQQ A;  1ZTR A;  4S05 A;  2Q0O A;  2FJ1 A;  2HVR A;  2CH0 A;  4RM3 A;  3HKZ A;  1WJC A;  3V42 A;  4J01 A;  3BR6 A;  4C2U A;  3HUG B;  4ZZL A;  1YQA A;  5IYD J;  2UV1 A;  5KK1 A;  2OCC H;  2A6T A;  1ZRC A;  2GQQ A;  2LBF A;  1HXD A;  5F0H A;  2D1V A;  3EUH A;  2VBX A;  2GXA A;  1FOX A;  2ZXW H;  3S8P A;  1UMQ A;  3DLA A;  4P1W A;  2NVX J;  3CCV I;  2GXG A;  3HOV J;  3BT9 A;  4ETS A;  1P92 A;  3W6J B;  4XKC A;  3V8J A;  1EH6 A;  3HPG A;  5JLX A;  2ME6 A;  2LF7 A;  5IT9 Z;  3D5L A;  1GUU A;  4HV6 A;  1UG0 A;  2OA4 A;  3CJQ B;  4CZZ A;  2LNB A;  2NOJ B;  4I02 A;  3H9Q A;  3DEU A;  4KYW A;  1VQ7 I;  5FRO A;  1IDZ A;  3GLX A;  4U0V A;  1LFU P;  1SEU A;  1FLI A;  3QPS A;  3C2H A;  2LY1 A;  3BG5 A;  2XPV A;  4O5V A;  4YEJ A;  3PNV A;  5ICF A;  3J81 Z;  1B72 A;  1OCT C;  1U5T C;  1YX5 A;  5ILS A;  2WB1 A;  5J1Y A;  2VT2 A;  1R7J A;  3WTY C;  4L9T A;  3EET A;  4ENJ A;  3DBR B;  4RA2 A;  3VYR B;  1BJZ A;  1XDU A;  3A0B C;  2MYS A;  5HLH A;  3WTW C;  4FIS A;  3N05 A;  4LD5 A;  2DMQ A;  3KIO A;  3TW6 A;  1R1U A;  3F72 A;  3JRC A;  3SZT A;  3MKZ A;  2IP2 A;  4B3X A;  5JFR A;  1TP4 A;  3L2W A;  1IW7 F;  5DUI A;  4B8X A;  5D5W B;  3PO2 J;  2FNA A;  3WG7 H;  2LC2 A;  1HKS A;  4XON A;  2VC0 A;  4BEH B;  4PK4 A;  1FYM A;  3X2Q H;  1JXS A;  1FMV A;  4XKB A;  3RJP A;  3LWF A;  2JMW A;  5J8F A;  1O3Q A;  2EIM H;  1T33 A;  1W7P B;  2IJL A;  2Y9Z A;  2ZNZ A;  2A6H F;  2M2E A;  5FFX A;  4KT5 C;  1NH3 A;  2HQA A;  1JHH A;  3H9J A;  2DN0 A;  3NWS A;  4IPA A;  1FTT A;  5ILV A;  1KA8 A;  2ZJP F;  2IS1 A;  2XHK A;  4X1E A;  3G3Z A;  2STW A;  3ZN1 A;  3OYK A;  3HOZ J;  1KGS A;  3KLN A;  4GDF A;  2CWE A;  5FD6 A;  4DBR A;  3JAM Z;  4G12 A;  2VQC A;  4D9J A;  4PJN A;  4RB2 C;  1X1P A;  2ZME B;  1TQM A;  3ZQF A;  2I8D A;  3R4K A;  4P96 A;  3CCQ I;  2DK8 A;  3I3L A;  5K7H A;  1R36 A;  2VJI A;  4MFD A;  4XRS A;  4LG0 A;  5C44 J;  4XRM A;  2XC7 A;  3FXU A;  3RI4 A;  1KZH A;  3HXL A;  3K4M A;  4BKX A;  1QZZ A;  4A12 A;  3CQZ J;  2L7M P;  4CYC A;  2HTJ A;  5FJ8 J;  5J3L A;  1U0J A;  5B1A H;  5CPR B;  5LGU A;  4ASN A;  4JQF A;  3HOS A;  1MMG A;  4IRI A;  3IH3 A;  1YJW I;  1A36 A;  3OYC A;  2DA7 A;  5F0F A;  1STZ A;  3QWL A;  1MKM A;  2LR8 A;  5E8I A;  3HIF A;  4F55 A;  1D0X A;  1LJ9 A;  1VQ9 I;  2HVQ A;  3FX3 A;  3LAJ A;  3G1L A;  3GCM A;  3LNQ A;  2IS2 A;  5EEG A;  4M3G A;  3I9V 2;  1EYF A;  2RQQ A;  2BY1 A;  2K3P A;  2K9M A;  5K7Z A;  2BXZ A;  4RB0 A;  5FRN A;  4U0Y A;  1JTX A;  2KT0 A;  1WZ2 A;  1WKM A;  4GYG A;  1YS6 A;  4L0Z B;  4HF1 A;  1I39 A;  1SVO A;  2RVC A;  5HOO A;  4QTR A;  5HDK A;  4HST A;  3VSK A;  3ZPL A;  4BAY A;  3JRD A;  3SYT A;  1WRJ A;  2V1U A;  2WWY A;  1E3O C;  1OKR A;  3LA2 A;  3V8K A;  3PNT A;  4CCN A;  3H0G J;  1R5I D;  4XLH A;  1P7I A;  4W1U A;  4AIJ A;  2FBI A;  2ESN A;  2R7R A;  2M0M A;  3B6A A;  2H27 A;  3QYE A;  3KEY A;  2R5Y B;  3MD2 A;  5TIS C;  2LK2 A;  2E1C A;  1NTC A;  1QVU A;  5EZG A;  1BOA A;  4I7H A;  1ZGW A;  4RBO A;  5CJ9 A;  1HCR A;  5E3N A;  4GRI A;  3C7J A;  4PGH A;  4EEF G;  3DU6 A;  4BY7 J;  2JJ7 A;  4E7S A;  5LHH A;  2JN6 A;  2O5R A;  2QUF A;  2K7L A;  2DJI A;  2ZXJ A;  3L7W A;  2FXA A;  4G6D A;  3VYU B;  3OYG A;  2R7X A;  2ZFU A;  2IBD A;  1V4R A;  5IT9 K;  2B0L A;  5FKN A;  3E97 A;  3SZP A;  5HS8 A;  3CC2 I;  4AVP A;  1SFE A;  1TWG J;  1TWA J;  2XGD A;  4I0A A;  1TWF J;  3FIS A;  1HF0 A;  1P7J A;  4XKW A;  2PG4 A;  2Y0S A;  2OTJ I;  4E7H A;  3S3O A;  3KP4 A;  1FBQ A;  4UUS B;  2PX9 A;  1FOK A;  4XM3 A;  1ETQ A;  4A3D J;  4HW0 A;  1Y8R B;  2VJ4 A;  3ZGK A;  2ETH A;  2W85 A;  2VB6 A;  3GTL J;  1JKP C;  4I01 A;  1KU3 A;  2L4A A;  2CRG A;  3ONQ A;  3CMY A;  2KPM A;  1BR2 A;  3RQI A;  4GYI A;  4KDP A;  2LG4 A;  1JGG A;  2GZW A;  5D8K B;  2GA1 A;  1GV2 A;  3AG2 H;  4LLL A;  3ABK H;  4IHX A;  1OR7 C;  5E17 F;  3GXO A;  4KIG A;  4FX0 A;  1U78 A;  1YG2 A;  4I2O A;  3BG9 A;  4IEJ A;  3IUO A;  2KIS A;  2YU9 J;  1AOY A;  1OMI A;  1N78 A;  2JA5 J;  2Q1Z B;  4KIF A;  5LRR A;  4D5C A;  2MD0 A;  4IHS A;  4PJ0 C;  3JAM K;  1XG1 A;  2W7N A;  3HUG A;  2LRD A;  5DCM A;  1GHC A;  1U2W A;  2NVU B;  4ENK A;  6PAX A;  3HOX J;  4BXU A;  3I55 I;  2HOS A;  1SD7 A;  2M7B A;  1RKT A;  4I76 A;  4B1R A;  4XIC A;  1R71 A;  2JRT A;  2PJR A;  3ML6 A;  3ZCO A;  1H0M A;  2E1O A;  1B4A A;  3HSE A;  4Y33 A;  1EF4 A;  2E2J J;  1J2X A;  2VBY A;  1IRX A;  3K2A A;  2D1H A;  3G2B A;  1J09 A;  2IT0 A;  2R7F A;  3OIP A;  1S7O A;  1IUY A;  2V6E A;  1BBY A;  4HZF A;  3BWG A;  4AID A;  1H9G A;  1YOV B;  1QZY A;  4KN7 X;  4BE1 A;  4EM0 B;  1S7A A;  2XUB A;  4MQ9 F;  3AFH A;  1OIS A;  2O3F A;  3NAR A;  3ECO A;  3TOA A;  1RES A;  3FK6 A;  3WOD F;  2L9V A;  3DQV C;  3ECH A;  5HVQ C;  2Z33 A;  2OZU A;  1IN7 A;  2OF7 A;  2LTP A;  4BDZ A;  2W1O A;  3E6B A;  3FBI B;  2K85 A;  4PDK A;  3LFK A;  2QKL B;  2VPL A;  4KMU X;  2XAJ A;  2Q8K A;  1IN5 A;  4R79 A;  2XGE A;  3JSO A;  3IKV A;  1XTA A;  3V4G A;  4EJU A;  3Q9S A;  1TC3 C;  2HQR A;  2NVY J;  1MBF A;  5ED4 A;  2F6C A;  2X6O A;  1BIB A;  2FNP A;  1F43 A;  3PSF A;  5JHU A;  5J8C A;  4BEH A;  4E7L A;  2Y2Z A;  1HQC A;  3TOB A;  3UR3 C;  4MTE A;  4ZDP A;  4XKV A;  2DA5 A;  5M5W J;  3TED A;  1FNN A;  4A3L J;  3BPV A;  4NC8 A;  2XSD C;  4A3J J;  1AKH A;  3ROU A;  2W25 A;  4W97 A;  5H20 A;  1ON1 A;  2LBF B;  3CF2 A;  3TMO A;  3F23 A;  2K9Q A;  3S2D J;  4I98 B;  2IGO A;  2VI6 A;  2OTL I;  1WH7 A;  4UV9 A;  1BI3 A;  2DU9 A;  4FQG A;  4L9J A;  2R3S A;  1R6R A;  4PZJ A;  2ZME A;  5TRD A;  1EJ9 A;  1HBX G;  3K4K A;  1B9M A;  1BR1 A;  1JUM A;  4LB5 A;  4WX9 A;  3BCB A;  4Q5S F;  3K1M A;  1HST A;  2VOD A;  1ULY A;  3OYL A;  5HLI A;  3S16 J;  4U88 A;  1FSE A;  5EEA A;  2DQR A;  5GAG J;  2XDV A;  1EV7 A;  1IRF A;  1Z67 A;  3CZ6 A;  2H1K A;  5LHG A;  3BR0 A;  4AYB A;  1GV5 A;  1B72 B;  2WY8 Q;  3HRU A;  4RS8 A;  4XOR A;  1FBS A;  1FJL A;  3A02 A;  1O3S A;  1X1A A;  3W2A A;  4IX7 A;  2O7O A;  4OIQ F;  1QZE A;  1EH7 A;  3H9G A;  4LIT A;  1ZGJ A;  1W4M A;  1UCR A;  1LVA A;  3F8C A;  3QQA A;  2F5C A;  2JA7 J;  1FIP A;  2IPQ X;  3E3V A;  4KNY A;  5CVU A;  4M9Z A;  2DFH A;  2XF5 A;  4HNT A;  4HBL A;  1MNM C;  1Y56 A;  3DEE A;  1BW6 A;  4UB6 C;  2VJ5 A;  5J40 A;  5LEK A;  2CQX A;  2XAQ A;  2DTR A;  4ZDL A;  3TP3 A;  5FB2 A;  3S32 A;  5F1J A;  2E7X A;  3ZQ7 A;  3E5U A;  2M0C A;  1TBX A;  4X0G A;  4CGZ A;  5FD5 A;  1ETO A;  1MBH A;  3BJ6 A;  3J7A Y;  3IAM 2;  3PO3 J;  3RIR A;  1D8J A;  4RAG A;  1UG2 A;  2DA2 A;  5GAD J;  3M8F A;  1MMS A;  4M6Y A;  4XOP A;  1UHS A;  1VFC A;  1X1B A;  1BIA A;  4M9S A;  4OMZ A;  1QNT A;  1ODD A;  4EJV A;  1Z77 A;  1ZAO A;  2IW5 A;  2X9D A;  3W3C A;  2VQG A;  1K4S A;  5KAI C;  2ISZ A;  1R00 A;  3AL0 C;  2DFE A;  3CDH A;  4N9H A;  2OUM A;  4IQJ A;  4A6D A;  2NAZ A;  4MO7 A;  5L3C A;  1DGW Y;  4CHU A;  2MH2 A;  4LG0 B;  3KLO A;  4LK1 F;  1V55 H;  2CYY A;  1IAW A;  2L7F P;  2I5U A;  5DCF A;  3CTA A;  1G3S A;  4L9V A;  4ZZD A;  1D1C A;  2ZBK A;  3CJR B;  3SFI A;  3GX4 X;  4CYC B;  1NHA A;  2V1D A;  5C4J J;  2F4M B;  2CW0 F;  3HHG A;  3SQN A;  3GVA A;  3H5N A;  5B5E C;  2M87 A;  3BCA A;  2LRE A;  5BQT A;  4NDL A;  2DA1 A;  1IJW C;  2DQL A;  1JUS A;  3A4C A;  4M3B A;  3WE2 A;  5KHD A;  3CMA I;  2QEN A;  1YTY A;  1C0W A;  3FIW A;  4LK0 F;  1HW1 A;  2FOK A;  1BJA A;  4XLP F;  3QRF F;  3U1D A;  4HNV A;  4ESF A;  2OU2 A;  1FWZ A;  3WTX C;  1PP8 F;  3ZOB A;  3HOW J;  2R7S A;  2M8G X;  1YS7 A;  2Y69 H;  1LPQ A;  1IRZ A;  4XLA A;  2DLL A;  2H8W A;  2E1M B;  2JA2 A;  1LQ1 A;  2DK5 A;  4YIF A;  3VDX A;  2LF8 A;  3QYB A;  3U1K A;  1VQ4 I;  3W6V A;  4XOT A;  2HOA A;  2UWM A;  3DEW A;  3LSH A;  1QVT A;  3RSN A;  3I54 A;  4BBS J;  3BRO A;  2UXX A;  3S3N A;  1SFX A;  4LFU A;  3VB2 A;  2GIZ A;  3FZV A;  3K6G A;  1PUE E;  4AU7 A;  4FE4 A;  4G6T B;  1AU7 A;  2EFP A;  2Z16 A;  5EJC A;  3EUH C;  1J0R A;  4UVB A;  1Y8Q B;  2QQA A;  2XF6 A;  4OAY A;  5C4X J;  1ETV A;  3EPZ A;  3CLQ A;  4L9N A;  2MC3 A;  1WJ5 A;  1MIJ A;  1VND A;  4M74 A;  5DDG A;  3NEU A;  1ONV A;  1R4M B;  1D5Y A;  3GUD A;  3CCU I;  3L1P A;  2YS9 A;  5BPD A;  5KVR A;  4IO9 F;  2CV0 A;  2MGQ A;  5JVT A;  5FLX Z;  4BXX J;  2V26 A;  2FQ4 A;  4GGG A;  4BXF A;  3DBH B;  3I0T A;  2K9S A;  3OR1 C;  2QQ8 A;  2DOA A;  2DAO A;  4LGW A;  3U2R A;  4CDG A;  3J7A O;  3WTV C;  1IC8 A;  2ZKZ A;  5KNL A;  3IKT A;  2X85 A;  2E5Z A;  3HEF A;  5F27 A;  4IHW A;  2LD5 A;  3B6C A;  3BR3 A;  3M3Y J;  2DMP A;  3KZY A;  3WE3 A;  2EIK H;  3BY6 A;  3ZQI A;  3KP6 A;  5EGO A;  4DYR A;  2DOE A;  3GTO J;  5M5Y J;  4Y13 A;  3TP0 A;  3MKL A;  1U9N A;  5F04 A;  3IAS 2;  5M3M J;  4MQV A;  1ZR4 A;  2CMP A;  5D6E A;  1H88 C;  1YW7 A;  1X4P A;  3HTS B;  2YSR A;  4RLQ A;  3CC4 I;  1MJA A;  2PQ8 A;  5ICE A;  2JVH A;  3CCM I;  3UNG C;  1KQ0 A;  2EZH A;  2DMN A;  4NHJ A;  1PUF A;  2JQ7 A;  1WJA A;  4BHB A;  1SC7 A;  4AWX B;  1Z0X A;  4M3E A;  2HDC A;  3S1N J;  3E1S A;  3O8H A;  3G6E I;  2F2E A;  4HNU A;  2COB A;  1RET A;  2DA3 A;  2PMZ N;  4PCQ A;  3B02 A;  5JHF A;  5J1R A;  4D1Q A;  2NVQ J;  5KAF C;  1GXQ A;  2DA4 A;  3ASO H;  4PSX A;  2O8X A;  3OYD A;  1WI9 A;  3N97 A;  2EA2 A;  5JVG F;  1P2F A;  2QEX I;  3CUQ B;  5ILU A;  2UXN A;  3N4M A;  2OBP A;  3F8M A;  5DCM B;  2IXS A;  1LDD A;  3GZ6 A;  2CV2 A;  2V1N A;  4L5J A;  4UVA A;  1EKE A;  1NG7 A;  4DJA A;  2IGM A;  3E6C C;  2PJR B;  3L09 A;  3KZI C;  4R1H A;  2A6E F;  2XKP A;  2MSY A;  2A61 A;  1UFM A;  4Y3O A;  2BEO A;  1WPK A;  1W0U A;  3F21 A;  3R0J A;  5CLS A;  3KCC A;  2LVS A;  3LSJ A;  2CQK A;  5FKL A;  2QSF X;  5E1Z B;  3AG4 H;  3OYH A;  3G1O A;  3K4L A;  5L3E A;  2ZO4 A;  1DP7 P;  1V5F A;  5TGT A;  1Z6R A;  1T2K A;  2RDP A;  4LMY A;  3S2H J;  1FOW A;  4KT6 A;  1G6N A;  4P5O A;  1VQN I;  2OAZ A;  3SHF A;  3F22 A;  1G8X A;  2MG4 A;  1B9N A;  3ZR8 X;  4HAM A;  4V2F A;  2HEO A;  2JTV A;  2P0W A;  3ZMV A;  1ZG5 A;  3I64 A;  3VEP A;  3LSI A;  3BZ6 A;  1BR4 A;  2W84 A;  5B66 C;  3OYA A;  1UHM A;  3GTP J;  5K5O A;  5H6R A;  1ZKG A;  2QSG X;  4XSX F;  4J00 A;  1TT0 A;  2YX7 A;  3I58 A;  1UAA A;  1MBK A;  3ZMS A;  1HDD C;  2EFN A;  4UVC A;  4FE7 A;  2VBZ A;  2IA0 A;  1IXS B;  4EJW A;  1L0O C;  3RKX A;  1QA6 A;  2HKO A;  1BC7 C;  3T1B A;  3ESW B;  3RKY A;  1JUP A;  4XSZ F;  1SD4 A;  3H5R A;  4UUT A;  1ACI A;  3Q0V A;  1CQT A;  2JWT A;  1XMX A;  2G9W A;  2EFQ A;  2RV8 A;  3HKZ N;  4F92 B;  2BHY A;  4FAS D;  5IPA A;  3C3W A;  5JI6 A;  4C2M J;  1AKH B;  3C1D A;  5DM7 F;  4PUS A;  4FX4 A;  1QBJ A;  1JKR C;  2WTE A;  4C3I J;  2X1E A;  3Q9V A;  4YFX F;  3A01 A;  3PL8 A;  5F1R A;  2OCE A;  4C2T A;  4LJZ F;  1R5H A;  3QU6 A;  2DYS H;  3H3V K;  3DKY A;  2VT3 A;  3GF2 A;  1YIO A;  2CUE A;  2DCE A;  2YU3 A;  4CCJ A;  3I53 A;  3ERE D;  3CCE I;  4AM3 A;  4IZZ A;  1P9Q C;  5D5X B;  1T0F A;  1XGM A;  5CQG A;  1X3Z B;  1R1T A;  3CUO A;  2NNN A;  2KIQ A;  1WJF A;  1VQ5 I;  2K86 A;  1OYI A;  2ZCW A;  4M3F A;  2KDZ A;  4E7J A;  2P4W A;  3HTU A;  2JZY A;  4ZYD A;  2GWR A;  1MJB A;  2CUJ A;  4A3G J;  2P81 A;  4G6Q A;  4G9Y A;  2XGC A;  3L2R A;  1YHQ I;  5DEQ A; 
#chains in the Genus database with same CATH homology
 4A3I J;  2EZL A;  2E2H J;  4Y7N J;  1ZR2 A;  3WHB A;  2JA8 J;  5EYR A;  2WB1 N;  4A93 J;  3HOX J;  3BQY A;  1Y1V J;  4B1R A;  1DU0 A;  1RKT A;  4I76 A;  4XIC A;  2HOS A;  1G2H A;  3S1Q J;  1NK2 P;  3IH4 A;  3VPR A;  1MBE A;  5EF6 A;  2E1O A;  1X2N A;  2LLK A;  1JT6 A;  1EF4 A;  2E2J J;  3FKI J;  4GFB A;  3K2A A;  5IOY A;  1OCP A;  4M6V A;  3I4N J;  2R92 J;  3JRA A;  2RAE A;  3GBG A;  2HOT A;  1ADN A;  2GBY A;  3PM1 A;  2R5Y A;  1RR7 A;  5JLW A;  5IYB J;  2HDD A;  4A3K J;  1K61 A;  3ZQC A;  4DZP A;  3NAR A;  3OSG A;  1RES A;  3FK6 A;  3JR9 A;  3MN2 A;  1I50 J;  4JP0 A;  2OF7 A;  5IYC J;  2LTP A;  2LP0 A;  3SDG A;  1JJ8 C;  3A03 A;  5GPA A;  3Q3S A;  3BTL A;  2WAQ N;  1ZQ3 P;  4D7N A;  1JKO C;  1QRY A;  4S0H B;  2L7Z A;  2XGE A;  3G1M A;  3HBL A;  4A69 C;  4UUS A;  4DW6 A;  1TC3 C;  2NVY J;  3FK7 A;  2GM4 A;  1MBF A;  2DMU A;  2X6O A;  1JKQ C;  1F43 A;  2EH3 A;  1LFB A;  1ZK8 A;  2I10 A;  3JRI A;  1MSF C;  2Y2Z A;  2NOG A;  3TED A;  5M5W J;  2DA5 A;  4A3L J;  4D5F A;  2XSD C;  1IUF A;  4A3J J;  5FKK A;  1AKH A;  2L0K A;  3CCY A;  3RZO J;  4W97 A;  2CQQ A;  1JT0 A;  1MBJ A;  1ORK A;  2HQ5 A;  1SFO J;  3GTQ J;  3HGG A;  1WI3 A;  1H89 C;  2K9Q A;  3JRG A;  1CQT A;  3S2D J;  5FKM A;  1FTZ A;  4A3M J;  2VI6 A;  1WH7 A;  2WV1 A;  1YRN A;  5M3F J;  1GVD A;  4B4C A;  1JUM A;  1RPW A;  2ECC A;  3BTC A;  3BR1 A;  2K40 A;  3S16 J;  1OJL A;  1APL C;  1VF9 A;  5IOZ A;  3TW7 A;  1S7E A;  5EEA A;  1BA5 A;  2QF7 A;  4MFE A;  3D1N I;  2H1K A;  2R7Z J;  4QSH A;  3BR0 A;  1GV5 A;  1B72 B;  2E19 A;  1FJL A;  1I6H J;  1WH5 A;  4XRS G;  2K9N A;  2ECB A;  3A02 A;  3BQZ A;  2O7O A;  4Y52 J;  4X6A J;  1MSE C;  2DMT A;  3IH2 A;  3QQA A;  2ID3 A;  2XB5 A;  2TCT A;  4DYC A;  2JA7 J;  3F0C A;  1FIP A;  2VPR A;  2M9H A;  4I6Z A;  1OFC X;  3BG3 A;  4JX5 A;  5GP9 A;  2XPW A;  1MNM C;  2L9R A;  1AHD P;  4M3D A;  1BW6 A;  2VKV A;  2CQX A;  3HOU J;  4MIM A;  2E2I J;  2DTZ A;  3TP3 A;  3CDL A;  5F1J A;  2M0C A;  1TWC J;  1ETO A;  1MBH A;  2ELK A;  3PO3 J;  2Y31 A;  2MW8 A;  4DZJ A;  3ZQG A;  1UG2 A;  2DA2 A;  2IAI A;  4MLO A;  2ME0 A;  4JX6 A;  3HOY J;  2Y0S N;  1UHS A;  1VFC A;  3E7L A;  4V2G A;  1Z77 A;  2X9D A;  3S14 J;  1TWH J;  5EGO B;  1JJ6 C;  2R0Q C;  2M34 A;  5GPC A;  4MO7 A;  2ID6 A;  2JK3 A;  3LSR A;  3SJM A;  1GDT A;  5HOD A;  2GLO A;  1MH4 A;  2L7F P;  3RKQ A;  3QPL A;  2AO9 A;  9ANT A;  3SFI A;  3WHC A;  1ZTR A;  4CYC B;  2FJ1 A;  5C4J J;  5EZH A;  3BR6 A;  1GT0 C;  2LKX A;  5BNG A;  4NDL A;  2DA1 A;  1IJW C;  1ETW A;  3I4M J;  5IYD J;  3JRF A;  1JUS A;  1PUF B;  4M3B A;  2HXI A;  3FIW A;  4B3A A;  4HNV A;  1BW5 A;  5F0H A;  3HDD A;  2XPU A;  3ZOB A;  3HOW J;  2M8G X;  1IRZ A;  1UMQ A;  3OIO A;  4BBR J;  2NVX J;  3UKG A;  2IEK A;  3BT9 A;  1WGX A;  3HOV J;  3LOC A;  5JLX A;  2ME6 A;  2AHQ A;  3W6V A;  4C3H J;  1GUU A;  1BL0 A;  2HOA A;  3MVP A;  3DEW A;  1QVT A;  4XK4 A;  4BBS J;  3Q0U A;  1HLV A;  1IDZ A;  1LFU P;  3JRH A;  4JYK A;  4BY1 J;  1POG A;  3QPS A;  3DCF A;  3BG5 A;  1B72 A;  2XPV A;  2QCO A;  1OCT C;  2H8R A;  1ENH A;  2CJJ A;  1A6I A;  5J1Y A;  4FE4 A;  1AU7 A;  1T56 A;  1BJZ A;  1X58 A;  4FIS A;  1HOM A;  2DMQ A;  5C4X J;  1ETV A;  3TW6 A;  1ETK A;  3JRC A;  3O8G A;  3GTJ J;  2XRL A;  4AC0 A;  1VND A;  3PO2 J;  2LFB A;  2R93 J;  1D5Y A;  2HYJ A;  3L1P A;  2YS9 A;  2FX0 A;  2G0E A;  1W0T A;  3LSG A;  2JMW A;  1T33 A;  2MGQ A;  2Y9Z A;  2M2E A;  1MH3 A;  4BXX J;  1FTT A;  2FQ4 A;  2DN0 A;  1ITY A;  1SAN A;  5IP9 J;  3OSF A;  2K9S A;  4ABZ A;  4X1E A;  1IC8 A;  4FTH A;  4L5E A;  1FIA A;  3HOZ J;  3RZD J;  2N8G A;  3HEF A;  5F27 A;  4IHW A;  2LD5 A;  3B6C A;  3BR3 A;  3M3Y J;  2DMP A;  4G12 A;  3ZQI A;  2EZI A;  1I3Q J;  1FEX A;  5EGO A;  5DS9 A;  3HGY A;  3ZQF A;  4DYR A;  4C3J J;  3GTO J;  5M5Y J;  3TP0 A;  5K7H A;  4MFD A;  3MKL A;  5K7F A;  4XRS A;  1U9N A;  5F04 A;  3IV5 A;  4A3C J;  5FLM J;  2W48 A;  4XRM A;  2DA6 A;  5M3M J;  5EG0 B;  5C44 J;  1ZR4 A;  4BKX A;  1IV6 A;  2HXO A;  1H88 C;  3CQZ J;  4QIW N;  2NVT J;  2L7M P;  4CYC A;  5IP6 A;  5FJ8 J;  5J3L A;  1R9T J;  3A01 B;  4AUX A;  3JRE A;  3IH3 A;  2B63 J;  2XB0 X;  3GTG J;  2JA6 J;  2EZH A;  3BTJ A;  2R5Z B;  2DMN A;  2DA7 A;  5F0F A;  1PUF A;  2LY9 A;  1Z0X A;  4M3E A;  5E3O A;  3K7A J;  5EDN A;  5FLV A;  3S1N J;  1A5J A;  3O8H A;  2COB A;  1DU6 A;  2LR8 A;  1RET A;  2DA3 A;  1NK3 P;  2PMZ N;  5J1R A;  1HDP A;  1U9O A;  2NVQ J;  3LSP A;  1XC5 A;  2DA4 A;  4FCY A;  3G1L A;  3LNQ A;  1B8I B;  3S17 J;  1LE8 B;  3S1R J;  2X48 A;  4M3G A;  1JTY A;  1EYF A;  1MBG A;  4D7M A;  1VI0 A;  4AYB N;  5K7Z A;  1O4X A;  3C2B A;  2KT0 A;  1JTX A;  2Y30 A;  2VUM J;  3OOU A;  3HB9 A;  1IGN A;  4QTR A;  3BTI A;  3GTK J;  2MSY A;  3JRD A;  5FKO A;  1E3O C;  1WPK A;  3H0G J;  1W0U A;  2LVS A;  1F36 A;  1P7I A;  3LSJ A;  4W1U A;  5FKL A;  3JRB A;  4A3F J;  1H8A C;  3B6A A;  3G1O A;  4DYQ A;  4XID A;  2R5Y B;  1IG7 A;  2LK2 A;  3S2H J;  1NTC A;  1QVU A;  5EZG A;  1ZGW A;  4RBO A;  5M5X J;  1HCR A;  4IHY A;  5E3N A;  2MG4 A;  4V2F A;  4EEF G;  1Y1W J;  5E3L A;  4BY7 J;  2JJ7 A;  3M4O J;  2JN6 A;  1WCM J;  1ETX A;  3ZQH A;  1U8B A;  5DTD A;  3GTP J;  5F0C A;  1ZKG A;  2IBD A;  4LOC A;  5FKN A;  3GTM J;  2D5V A;  1MBK A;  2O9L A;  1HDD C;  1TWG J;  1TWA J;  4FE7 A;  2XGD A;  1ETY A;  1TWF J;  2EZK A;  3FIS A;  1HF0 A;  1P7J A;  2EBI A;  2Y9Y A;  1Q1V A;  4RDU A;  4UUS B;  1QPI A;  1JUP A;  1ETQ A;  4UUT A;  3ZQL A;  4A3D J;  1XS9 A;  3Q0V A;  3Q0W A;  2EQR A;  2JWT A;  3GTL J;  4J19 A;  3HKZ N;  1JKP C;  2CRG A;  2CUF A;  3CMY A;  2O8K A;  1K83 J;  5IPA A;  5E3M A;  4C2M J;  5EG0 A;  1AKH B;  3RQI A;  1JGG A;  1JKR C;  4C3I J;  1RKW A;  3A01 A;  2HI3 A;  4IHV A;  3S1M J;  2ZB9 A;  1GV2 A;  4IHX A;  3BR5 A;  5J1U A;  3NAU A;  2R5Z A;  3H3V K;  2DJN A;  3BR2 A;  1U78 A;  2VKE A;  3BG9 A;  2CUE A;  4IEJ A;  1YRN B;  2YU9 J;  2NS8 A;  3S15 J;  4A3B J;  2JA5 J;  1IDY A;  4D5C A;  3HM5 A;  4A3E J;  5F08 A;  2OPT A;  2FD5 A;  2TRT A;  4M3F A;  2KDZ A;  2NS7 A;  4JX4 A;  1B8I A;  1LE8 A;  2YUS A;  5IP7 J;  4A3G J;  2P81 A;  2XGC A;  5C3E J;  1X2M A;  1XG1 A;  2CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...