1U8BA

Crystal structure of the methylated n-ada/dna complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
131
Chain Sequence
MKDDQRWQSVLARDPNADGEFVFAVRTTGIFRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*AP*AP*AP*TP*T)-3'
publication title A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 131
sequence length 132
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00165 HTH_AraC Bacterial regulatory helix-turn-helix proteins, AraC family
A PF02805 Ada_Zn_binding Metal binding domain of Ada
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1u8bA02
3.40.10.10 Alpha Beta 3-Layer(aba) Sandwich DNA Methylphosphotriester Repair Domain DNA Methylphosphotriester Repair Domain 1u8bA01
1F43A 3RZDJ 2DMPA 2E19A 3S1RJ 3JRDA 3BR6A 5EF6A 3S17J 2Y30A 4A3EJ 2X6OA 1S7EA 2JA8J 4MIMA 1POGA 4QTRA 1H89C 1WGXA 1Y1WJ 4M3EA 5IP9J 2CUEA 5BNGA 4A3BJ 3NAUA 1ITYA 3TP3A 2O9LA 3S14J 2MSYA 2Y0SN 2DMUA 4A69C 1EF4A 1Z0XA 2HQ5A 3A01B 2WV1A 2R5ZA 4M3GA 4DYQA 5C4JJ 5IP6A 1A6IA 4JX5A 1JUSA 2WB1N 3QPSA 2HOTA 4FE7A 4UUSB 2DTZA 2R93J 2NOGA 3ZQFA 2K9SA 1XS9A 1HCRA 4X6AJ 3HB9A 3FIWA 3HEFA 4Y52J 1BL0A 3TP0A 1JKQC 1AU7A 1P7JA 2ECCA 2GM4A 1PUFA 2R5YB 2OF7A 2R92J 3HGYA 3CMYA 1AKHB 3O8HA 4RDUA 1IRZA 2E2HJ 1O4XA 3HOUJ 3S1NJ 4ABZA 1MBHA 3G1OA 5C44J 1MH3A 4C2MJ 2XGEA 1F36A 4S0HB 3ZQCA 1U9NA 5GPCA 1WPKA 3NARA 4B1RA 3JR9A 3UKGA 2M9HA 1ETKA 1WH7A 3C2BA 3GBGA 3HDDA 4QSHA 1MSFC 1B8IB 4XIDA 3OSGA 2JA7J 5F27A 4FISA 5JLWA 5IYCJ 4X1EA 2EBIA 2HYJA 2M0CA 4XRSA 3QPLA 2NS7A 4W97A 4EEFG 1UHSA 4IHVA 4BBRJ 1TWCJ 5EGOA 2HXOA 3GTJJ 3PO2J 1IC8A 4XRMA 5M3MJ 4AUXA 1NTCA 2FJ1A 3BTLA 2L7FP 2JWTA 4BBSJ 2XGCA 1ETXA 2VI6A 5C3EJ 1APLC 3SJMA 4MO7A 1OJLA 2XGDA 2Y2ZA 5M3FJ 5E3NA 3DCFA 1T56A 1FIAA 4V2FA 3BR0A 3BR5A 1ETYA 1NK2P 1HLVA 3L1PA 5IPAA 2FX0A 3BQYA 5F08A 4D7NA 4A3JJ 2GBYA 2Y9ZA 2LK2A 3HGGA 2NVXJ 3ZQGA 2ID6A 1JKOC 5F0HA 4W1UA 4A3MJ 3BG5A 2AHQA 1IG7A 1Q1VA 3W6VA 3RQIA 2XPUA 4D5CA 2LY9A 5EZHA 1TWFJ 4A3CJ 5K7HA 1VI0A 2Y31A 4NDLA 2B63J 3FK7A 5EYRA 1VFCA 2EZLA 2VKVA 2EZHA 1SFOJ 1JKRC 4MLOA 3BR3A 5EDNA 3S16J 2L7ZA 4BKXA 3GTPJ 1MBEA 1LFBA 1UMQA 2E1OA 4AC0A 3FISA 4B3AA 2LKXA 3HOZJ 2IBDA 5IYBJ 2DA2A 2NVYJ 1U8BA 3S15J 1SANA 4CYCA 1BA5A 2VKEA 3H3VK 4D7MA 4B4CA 3DEWA 1ZK8A 4DZPA 4IHWA 3VPRA 1I50J 2W48A 3ZQLA 1LE8B 5JLXA 1RKWA 1JKPC 1TWHJ 1NK3P 2JK3A 1ENHA 2ZB9A 2LR8A 2XB0X 3TW7A 1I6HJ 4L5EA 3GTMJ 1RETA 1ORKA 1T33A 3A01A 3BTIA 2K9QA 1FEXA 1D5YA 5J3LA 1GV2A 3JRHA 2MGQA 2R5ZB 3JRGA 1QVTA 2MW8A 1OCTC 2L9RA 4UUSA 3K7AJ 3RZOJ 4HNVA 1QRYA 2R0QC 2KDZA 3ZQHA 5FJ8J 1X58A 2DMTA 2R5YA 2M34A 2HXIA 3BTCA 2ME6A 3BR1A 2QCOA 1AKHA 4C3JJ 2MG4A 3Q3SA 4A93J 5EZGA 2DA4A 3TEDA 4G12A 3K2AA 1ZR2A 1HOMA 4FE4A 2YUSA 1B72B 3D1NI 2JA6J 4QIWN 1TWAJ 1JTXA 1X2MA 3SFIA 5FKKA 4DZJA 1MSEC 2G0EA 5J1YA 1A5JA 1WCMJ 4A3GJ 1Z77A 2X9DA 5F1JA 2CU7A 1AHDP 1R9TJ 2DN0A 1K61A 1B8IA 3G1LA 1MNMC 1ETQA 3MN2A 1W0UA 3HM5A 2VUMJ 3RKQA 1U78A 4JX6A 5EEAA 2H8RA 5E3LA 4XRSG 3S2HJ 3HKZN 1HF0A 1H8AC 2E2JJ 1QVUA 3S1MJ 1ETVA 1GUUA 3MVPA 4IHYA 2K40A 2DMQA 2Y9YA 1DU0A 1E3OC 5FKMA 3BQZA 2PMZN 2D5VA 4MFEA 2M8GX 3GTOJ 1FIPA 1GDTA 1JT6A 3WHCA 1YRNB 2LD5A 3LNQA 2ELKA 1H88C 3H0GJ 1MBKA 4J19A 1IJWC 2JA5J 2R7ZJ 4A3KJ 3GTGJ 3IH3A 5GP9A 3SDGA 5M5WJ 1DU6A 2CRGA 2N8GA 1HDPA 3QQAA 1BW5A 1LFUP 1BW6A 2HDDA 1RESA 2XRLA 3BTJA 2IAIA 1ZTRA 2NS8A 2ECBA 2RAEA 4IEJA 1BJZA 3GTQJ 3I4NJ 2ID3A 2K9NA 2DMNA 5FKOA 2XPWA 4A3DJ 3JRIA 4Y7NJ 5J1RA 4M3DA 3JRAA 4RBOA 1IGNA 1QPIA 4IHXA 4C3IJ 2LTPA 5HODA 3JRBA 3BT9A 5EG0B 3IH2A 1OCPA 2TRTA 1CQTA 3F0CA 3FK6A 5E3OA 2LP0A 1MH4A 1JTYA 2M2EA 3PO3J 4UUTA 5K7ZA 1FJLA 4JP0A 4MFDA 2DA6A 3HOVJ 3GTLJ 3HOWJ 3PM1A 1IV6A 4LOCA 1Y1VJ 3CDLA 1GVDA 1TWGJ 3O8GA 1GT0C 2HOSA 5K7FA 4M3FA 1RR7A 5IOZA 4XK4A 4XICA 1WH5A 5FKLA 4DW6A 3M3YJ 4M3BA 1LE8A 2X48A 1XC5A 2EZKA 2OPTA 1XG1A 1JJ6C 4BXXJ 2QF7A 3Q0VA 4AYBN 2COBA 2P81A 3TW6A 3I4MJ 3FKIJ 1I3QJ 1PUFB 1RPWA 2NVTJ 4A3IJ 5J1UA 2CJJA 4C3HJ 1FTTA 2I10A 2GLOA 3S1QJ 5FLVA 1ZR4A 3BG9A 1IDYA 1ZQ3P 2YS9A 2JN6A 1K83J 3B6AA 4FCYA 5F0CA 1JGGA 3Q0UA 5F0FA 1B72A 4A3LJ 2EH3A 3B6CA 1GV5A 1ZGWA 4JX4A 5FLMJ 4A3FJ 1X2NA 2AO9A 2DA3A 1RKTA 2CQQA 2EQRA 2JJ7A 4BY1J 1ETWA 3G1MA 2L7MP 2YU9J 1EYFA 3BG3A 5IP7J 1UG2A 3Q0WA 2E2IJ 2TCTA 2FD5A 2DA5A 2WAQN 5F04A 1TC3C 3S2DJ 3ZOBA 5E3MA 3JRCA 1G2HA 1MBFA 3ZQIA 5EGOB 5M5YJ 3IV5A 1VF9A 3IH4A 2FQ4A 2O7OA 1ZKGA 2XSDC 3MKLA 5C4XJ 2XB5A 3LSGA 4V2GA 1P7IA 1HDDC 2NVQJ 2CUFA 1JUMA 3GTKJ 1WI3A 3A02A 2ME0A 3HOXJ 2L0KA 3LOCA 3WHBA 5M5XJ 2LFBA 2O8KA 3JREA 2VPRA 1YRNA 5DTDA 4DYCA 3OOUA 1JT0A 2IEKA 1ADNA 3OSFA 3CCYA 3OIOA 2HOAA 4M6VA 4I6ZA 4JYKA 2KT0A 1IDZA 4GFBA 3CQZJ 5GPAA 3LSJA 2DJNA 3A03A 1W0TA 1OFCX 3HBLA 5FKNA 3LSPA 3HOYJ 2EZIA 2DA7A 4I76A 9ANTA 5IOYA 1IUFA 2HI3A 3M4OJ 1MBJA 2LVSA 2LLKA 3E7LA 1ETOA 2DA1A 5DS9A 1VNDA 1MBGA 5IYDJ 2XPVA 4BY7J 2JMWA 3BR2A 1JJ8C 4D5FA 1FTZA 2CQXA 3JRFA 4FTHA 5EG0A 1JUPA 4CYCB 4DYRA 2H1KA 3LSRA 1U9OA
chains in the Genus database with same CATH superfamily
4IO9F 3S17J 2Y30A 3BOQA 2Y75A 3G4SI 4ZDOA 5FLXK 1FOWA 4A12A 1POGA 2AS5F 4M3EA 2ZNYA 3OYAA 5GAEJ 3J7AO 1J2XA 3TP3A 2L5QA 2XASA 3ROUA 2QSHX 3S14J 2L9NA 2Y0SN 4H0EA 1DP7P 3EUKL 1PP7U 4M6XA 2R3SA 2HQ5A 3KYLA 3MQ0A 2F4OB 2KHMA 2DTRA 1R23A 1R4MB 2GA2A 3FWEA 4E7HA 2KJBA 4CXFA 4YEJA 3QPSA 3FMRA 1T98A 1MIJA 2PEXA 3HRTA 3ZQFA 1HCRA 2JQ7A 3HB9A 1NG7A 4DGWB 3TP0A 3S2WA 1AU7A 2F2EA 2GM4A 2VXDA 1PUFA 4ESBA 3ZMVA 3HGYA 3CMYA 2XAGA 3HIFA 5J47A 1Z3XA 3TO6A 4NHJA 4U0WA 2L02A 4II2A 4ZZDA 5IY5H 4LLLA 4EQQA 5A2QZ 2HNHA 3RYRA 1EV7A 1GXQA 1MBHA 2NOJB 3S3OA 3JTHA 2H27A 1MH3A 2VT2A 2VQLA 2XGEA 3WU2C 4CYDA 5JI6A 3I53A 1U9NA 3OYJA 1VQLI 2K9MA 5HNHA 1VQMI 1X1CA 2A5YB 5LGTA 1A35A 5HS8A 2R7VA 1WJFA 2M9HA 1B4AA 3E6BA 2VXZA 5FROA 3GBGA 2L4AA 2IXSA 2E5NA 4XR6A 1V55H 3E5QA 4Y33A 4I02A 4IXAA 3WTVC 5FFZA 3F72A 2W4SA 3KEQA 4FISA 3OS0A 3OYEA 5JLWA 3KEYA 5IYCJ 3DFGA 2ZJPF 4ENNA 4OIQF 2V7FA 2M0CA 5BMZA 4LD5A 3VYUB 4EEFG 1IN8A 3HTUA 1WFXA 2LY1A 4HX7A 4NQWA 1Z6RA 2A6HF 2ELJA 2XAJA 4JOMA 1G6NA 3DPUA 1BOBA 2L7FP 3OR2C 2VB6A 3K1PA 4BBSJ 4UV8A 3L7WA 1QBJA 2QSGX 3GEZA 3DTEA 4A6DA 1OJLA 2Y2ZA 3OR1C 2QM3A 3H5AA 1MMAA 3DCFA 1VQ9I 4UNOA 2DQRA 3DEEA 4BHCA 2JVHA 1ZGAA 4OIPF 1UFMA 5DD8A 3L1PA 5IPAA 3BQYA 3LL7A 5F08A 4D7NA 1TL8A 4A3JJ 5DYMA 3C1DA 1UJ8A 3DPTA 1D0ZA 2ID6A 1JKOC 5B3SH 4RGUA 4W1UA 2H94A 2AHQA 4M9ZA 1KYZA 4JBAA 4MQVA 1FP2A 3O2PE 2X1EA 3FXLA 2CYYA 1IV8A 4LITA 2QKLB 3WTUC 4NDLA 1UB9A 4FASD 1DP3A 2BE5F 4BGDA 3HOTA 3QPHA 2EZHA 1JKRC 2ZMEB 2RDPA 3BR3A 1ZRCA 2WV0A 3IKVA 5EDNA 4PK4A 2HFHA 4M74A 2EIKH 3AG1H 4LK1F 2MABA 1GHCA 4XONA 2E1OA 2QSFX 4DBRA 3S3MA 2UWMA 4B3AA 1WI9A 2L4MA 1BI2A 2LKXA 5KCMA 4MHGA 3GUDA 2ZJ2A 3S15J 1YFHA 2M3AA 1HC8A 3RIRA 4UVAA 1FOYA 3WGGA 1WJAA 1Z05A 3N97A 2VKEA 1LVAA 2DLLA 3KLOA 3I0TA 2XV4S 4D7MA 2DO7A 3QRFF 4XKWA 1TT5B 1I50J 3BWGA 4BJ5C 4R8HA 3CJRB 1KYWA 2MD5A 1HXDA 1TWHJ 1VQ7I 2LR8A 4LB6B 3TW7A 1G3TA 1USTA 1QNTA 3BTIA 1T08B 3FXOA 5L3GA 2K9QA 1A36A 4WCGA 1GV2A 4I7HA 3JRHA 1R58A 4G9YA 2MGQA 4D0PA 3JRGA 2BY1A 1OCTC 1KU9A 2L9RA 4I99C 2R7RA 3G71I 2KDZA 2DT6A 2OA4A 2FU4A 2R5YA 1WWXA 2M34A 1O7FA 3CJQB 3BR1A 2QCOA 3J80Z 1AKHA 1KZHA 3M1EA 3GVAA 5GTIC 2MG4A 4M72A 4A93J 2PMHA 5EZGA 4J01A 3M9AA 2KDOA 2CW0F 3ISPA 2Q1ZB 4FE4A 1TNSA 2JRMA 5CKTA 1W36D 2M7BA 3HPGA 4FT8A 1DPUA 3D1NI 5E8IA 1X3UA 2J5PA 5LHHA 4KA4A 1QZYA 4BE2A 3CUQC 5FKKA 3SFZA 1KU7A 2G0EA 5J1YA 4NC8A 4A3GJ 1O7LA 2H09A 2JSCA 4G6QA 1K61A 3G1LA 1YW8A 2EPFA 2RVCA 2HVRA 3CDIA 3HM5A 3K4KA 3KZYA 4BYYA 2E1CA 2H8RA 5E3LA 3GMEA 2KZGA 1HF0A 2MH9A 2JUGA 1GUUA 3FKJA 2NAZA 1H9GA 3FXQA 2XF7A 2K40A 3GFJA 3BJAA 2X6WA 1Z7LA 3KIOA 4DJAA 4O5VA 1HBXG 5HS9A 4ZTJA 1X4PA 3CUQA 4N0BA 1Z67A 3H92A 1LNWA 2V9VA 2DI3A 4WXDA 4KNYA 1FIPA 2GZWA 2KZVA 3FXMA 1YYVA 5DCMB 3MKYB 3IWZA 4OAZA 4B47A 1USSA 1HKTA 3LNQA 2VBXA 3FXUA 2FQ3A 2NYXA 1IJWC 3R6SA 2R7ZJ 5GP9A 1BIBA 2ICWG 3SDGA 5M5WJ 1J09A 2VONA 2BZTA 4XLFA 2CRGA 2E1MB 2N8GA 4A5MA 2JSPA 2F6CA 1OLTA 1LFUP 1NG6A 4XN3A 3GFLA 2HDDA 3BPXA 1IRXA 2M1BA 1Y6IA 3COAC 1P2FA 2ECBA 1JGSA 1QZEA 2YSRA 3GTQJ 3LA7A 2FNAA 4KN7X 2XPWA 4A3DJ 4HV5A 3K10A 5J1RA 1HKSA 5JR3A 5H6QA 3CCRI 2OAZA 1J59A 1QPIA 4L0ZB 1K6YA 4IHXA 2Y69H 4IKFA 2F4IA 3KZIC 1M1EB 1MMGA 2OU2A 4XOPA 3E5XA 2V9KA 5HODA 1EJ9A 5K5OA 2QZ8A 5EG0B 1OCPA 1ULYA 3U2RA 2ISZA 4XSZF 3FK6A 4KJZA 4OAYA 2LP0A 2OUMA 1R1UA 2PMUA 3KX2A 5K7ZA 1FJLA 3GZ5A 2XAQA 3K4JA 2DA6A 1DQUA 4O3MA 3P9KA 3GTLJ 2DK8A 1LFPA 1EH7A 2XIGA 1T38A 3CDLA 4IL6C 2CQKA 3OYNA 2Y0SA 5DDGA 5KAIC 1GT0C 2DXIA 3QPTA 5TISC 4I09A 5K7FA 4AYBA 4M3FA 5IOZA 3V7SA 4OU0A 4DW6A 2ZC2A 2LREA 3K2ZA 3H9JA 3OYIA 4C2UA 3CJTB 1WJDA 2KIUA 1TP4A 2RQPA 1JJ6C 4BHPA 4WF2A 3HYIA 5LFAA 3Q0VA 4AU7A 5IT9K 1V5EA 1RRJA 2O3FA 2I8DA 3I4MJ 2R7TA 1HA8A 1OR7C 3PSFA 5DEQA 4ZDLA 1OCZH 4UHTA 1MNDA 1PUFB 2KL4A 3OL4A 4RLQA 2DOFA 2HKOA 3CP2A 2LKPA 2VKHA 3CCQI 3J7ZI 1MDMA 4G7OF 3ELKA 2I10A 1LDDA 3OYMA 5FLVA 2G9WA 1D0XA 2QQ9A 1V54H 4HYEA 3W2AA 3MZHA 3F8CA 2HQAA 1ZR4A 3O3KA 1QHHD 1WJ5A 1ZQ3P 2C6YA 4MGRA 3B6AA 4FCYA 3R0JA 5CYVA 4CCNA 1B72A 1R5HA 1ZN2A 2EH3A 1GV5A 1OR7A 1S3JA 1YTYA 2O6GE 2CQQA 2KRCA 5CQEA 1C0WA 2CW8A 3PSIA 4BE1A 2G7UA 2DA5A 2WAQN 1X1DA 2MFZA 2BW3A 1I27A 1MBFA 4NQWB 4IRIA 4LB5A 4BQQA 1FX7A 4LLNA 4N9HA 1R49A 3OYGA 1VF9A 1SVOA 3IH4A 2XSJC 4F93B 4HNUA 2O7OA 3IP4B 2XB5A 1RIOH 1HDDC 2IS2A 2H6BA 3GTKJ 3A02A 2EFOA 2L0KA 3LOCA 4ZYDA 2LFBA 1XMXA 3DQVC 3PNTA 3DEUA 3PNVA 1WJEA 4HEA2 2QQBA 1I1GA 4OWRB 1ADNA 1QQIA 3HSEA 1MJ9A 2F48A 2NNNA 4LIVA 3SXYA 4PJMA 1IUYA 4PFPA 2JZYA 3OL3A 1Y0NA 3RPUD 4X0GA 1R1VA 1IDZA 4GFBA 1E17A 2V1XA 3EETA 5F6FA 3A03A 1OFCX 2LRDA 2BXZA 2VE8A 5FKNA 1YX5A 5JVGF 1MKMA 1YW7A 2W1OA 2RNGA 2M4KA 4LG3A 1G3SA 2Z5UA 4BS9A 2F5VA 2B7EA 3GYHX 1EKEA 2JT1A 4YRVA 1IUFA 2HI3A 4HDVA 2KIFA 1UZCA 1DDNA 3TL4X 2CQNA 4N9IA 1VNDA 2JMWA 2DAOA 1ON1A 4D5FA 5D6EA 2WTEA 3W6KB 4CGZA 5AIQA 3H3UA 2W85A 5ILUA 2CV0A 1XN7A 3T5XA 3N05A 2D5VA 3RZOJ 5CVRA 5JHFA 4UB6C 2DMPA 5DM6F 3AKZA 4AIKA 3JRDA 3RZDJ 3DPLC 4IX7A 4IZZA 2DK5A 4QTRA 1SVLA 2JPBA 2IA2A 5FRMA 4E7KA 4F7ZA 4A3BJ 2WB1A 4MQ9F 5D8KB 1CGPA 2O9LA 3GO5A 1O3QA 1EF4A 1SAUA 2KPMA 1Z0XA 1R7JA 2M30A 2WY8Q 2EJRA 3F8BA 4M3GA 4NB5A 1VQ6I 1A6IA 1YIJI 2EV0A 2VQHA 4FE7A 1XDUA 1Z3YA 2DTZA 3SEZA 2R93J 2K9SA 3FIWA 3ZXSA 3HRUA 4F55A 1SFKA 3L2QA 4Y52J 1P7JA 2ECCA 3CF5F 1MNEA 2R5YB 2L9VA 2OF7A 1VQ4I 1X19A 1U2WA 2R92J 2WA0A 1AKHB 3O8HA 4RDUA 1KU3A 1IRZA 2KISA 3IAM2 2P8TA 1VQ5I 3HOUJ 2GXGA 5HDGA 4ABZA 4EGYA 2DYRH 3I4PA 3IL2A 2W00A 5CVIA 4C2MJ 2LBFA 1SD4A 3MCZA 3ZQCA 4S04A 1B59A 1WKMA 3ERED 4FQGA 4G6TB 4B1RA 3JR9A 1X4OA 3KYDB 4MEYF 1ETKA 1LB2A 4XKVA 3RSNA 1DGRM 3CESA 5K5QA 4XIDA 1YO5C 1MSFC 3A0BC 1HW1A 4IOCF 2UXXA 2LG4A 1R36A 3ONQA 1YE9A 4XSXF 2EFWA 5FD6A 2MC4A 2HPIA 3QPLA 5JVTA 4W97A 4QWQA 1XGMA 5B1BH 5TRDA 1UHSA 2WAEA 4IHVA 4R79A 3ESWB 2ZFUA 4LG0A 3CUQB 3PQKA 2DODA 4NC7A 1NTCA 1XGSA 3CLQA 3KYCB 4PCQA 5LGNA 4ENKA 1D8JA 3CO6C 2PLYA 3ABLH 1Y39A 1BJAA 5ICCA 3GZ6A 4CUGA 3SJMA 2HOEA 3CCMI 2L3DA 5E3NA 4QPOA 1FIAA 3LQRA 1OKRA 4KMFA 1IN5A 5FB2A 2R7QA 3ABMH 2HVSA 1FLIA 4DNCA 3ABUA 1NK2P 2P5KA 4HRIA 3QODA 4GO1A 1Z7UA 5K5RA 1IN4A 2Y9ZA 3G6EI 3K6GA 2NVXJ 1PYVA 1ERDA 4FETA 2K85A 5F0HA 1U5TA 2PFBA 1FNNA 2VL8A 3DLAA 4LJZF 5EZHA 1IO2A 1Z1DA 1Y8QB 3SEQA 2B63J 3FK7A 4XL9A 1VFCA 1N77A 2YX4A 2VKVA 2CO5A 1MZBA 1P4AA 3FBNB 2HS5A 3S16J 2H1LA 3MEXA 1MBEA 2EFQA 2IGOA 3RCOA 1LFBA 2ZXJA 3T8RA 3CO7C 3H5RA 2FNPA 2L7KA 3M8EA 3P5JA 1U8BA 3FX3A 1XMAA 3RPQA 2XKPA 3ML6A 3VWBA 3P7NA 4CSWA 1CF7A 1WZ2A 4QPQA 1G4DA 1LUJB 3K1NA 4IF4A 4XKCA 2MC3A 1J75A 1FOKA 5GAHJ 4E70A 1XCBA 5KAFC 1YS6A 1ZG3A 3VPRA 4M9XA 4GXOA 5ICGA 1A31A 4FX4A 3MFKA 4CICA 5H20A 1NK3P 3MD2A 5FO5A 4ASNA 1I6HJ 1RETA 1ORKA 1T33A 4RGSA 3A01A 1T8IA 4AM3A 1LEAA 1FEXA 1D5YA 3JTGA 2DJIA 1LVKA 3ZN0A 2R5ZB 3SDBA 3ZP5A 3W2VA 3ECHA 4UUSA 4HNVA 1QRYA 2R0QC 1KA8A 2X0LA 1HQCA 2HWVA 5CLSA 3SZGA 1BI0A 1XMKA 3WTZA 1I5ZA 1X58A 3ZQHA 5FJ8J 2V1UA 3K70D 4P55A 2DMTA 3E97A 3ZCOA 4XNFA 4YIFA 4MTDA 1MDMB 2M45A 1V4RA 4AIHA 4C3JJ 2LNBA 3QOPA 1ON2A 4EV0A 2OTLI 2TDXA 3H36A 2CGPA 3K2AA 1HOMA 3J81Z 2IS6A 2YUSA 1B72B 1LPQA 1HSTA 1VQ8I 2EWNA 2JA6J 1WHUA 5CQGA 3KZZA 1X2MA 3T8TA 2CQ7A 2YR2A 3LA2A 3LSTA 2VBZA 3RI4A 3I71A 4DZJA 1MSEC 1YS7A 3G2BA 2ACJA 1A5JA 4XOTA 1U8RA 2GXAA 3R4KA 4CO8A 3L2UA 1FYMA 3NRVA 1LDJA 4WXCA 2WAQA 1B8IA 1MNMC 1ETQA 4Y13A 2VUMJ 4V19K 2GWRA 3F8MA 1MW7A 2J5OA 2BW3B 4XRSG 1R00A 1IN6A 2E2JJ 2XROA 1ETVA 3HOSA 3S1MJ 3FMQA 4HLYA 2K27A 3HTSB 3IUOA 3GLLA 2PMZN 3L2CA 3JAMK 3KP7A 2M8GX 2IJLA 1P6RA 4KDPA 2EA4A 3SQNA 2W24A 2QQ8A 2AXLA 3QWLA 4CCKA 4Z2YA 5HDKA 2LD5A 3VB2A 2FUG2 5HLIA 2V6EA 3U1KA 1MBKA 3I56I 1DPRA 4A3KJ 2KIMA 4ZYHA 1FYLA 2FOWA 2STTA 2M87A 3GCMA 1HDPA 1BW5A 2JA7J 2VASA 2V26A 4RGXA 1TNTA 3DWLE 2HGCA 4RB2C 1RESA 2XRLA 2IAIA 1E0EA 2DYSH 4GGGA 1BM9A 4HW0A 4BNCA 4AIDA 1QU3A 2HVQA 2K9NA 5FLXZ 5FKOA 2P6SA 4M3DA 3BCBA 4HPQA 3JRAA 5E8GA 4D9JA 4RBOA 4J00A 1IGNA 3BROA 3LAJA 1R5GA 4AVPA 3TOAA 3CCLI 4IRGA 4BJ6C 3E6MA 2R7FA 5BOXA 1VQOI 4O6JA 2TRTA 3FHNA 3H1CA 3QYFA 3F0CA 5E3OA 1SD7A 4E7SA 5DUIA 3LMMA 2DCEA 2L01A 1MH4A 1JTYA 2M2EA 4M9SA 5HOOA 4PGGA 1ZG1A 2K5CA 4UUTA 1N25A 1SMYF 3Q5FA 3H0DA 3BC8A 1S7OA 4BXFA 1S7AA 2OJED 5JFRA 4RB0A 2VLAA 4LOCA 1XPXA 1GVDA 2P0WA 1R71A 3LFKA 5D5XB 2W57A 2RN7A 4PFOA 3SZTA 2X85A 5E20A 3M3YJ 2QGUA 3PFIA 4XLPF 3ZQ7A 1J0RA 4BXXJ 2CFXA 3RKYA 1T95A 4KFCA 2NXNB 2O61A 4YFKF 2COBA 2P81A 5KHDA 3TW6A 2JTVA 3MKWB 1RC9A 2VOPA 2QBYA 4A3IJ 4Q5SF 2GIZA 5GTHC 1IF1A 3CDHA 3CCUI 3S1QJ 1XSXA 2LBFB 3C2HA 4KIFA 3S3NA 2FE3A 4HF2A 2OC6A 3DKWA 4HSTA 1QA6A 2R4GA 2D1VA 3MAJA 4Q4ZF 1BBYA 3DKYA 3BG6A 3D0SA 1XCVA 1RZ4A 1YG2A 4XN0A 5EEHA 4HZFA 4B3XA 4P5OA 4HBLA 3QP6A 4RMNA 1X2NA 2DA3A 5L3CA 1U6GA 1ETWA 3FDYA 2YU9J 1X3ZB 1EYFA 3WE3A 1L0OC 1Y0UA 3L2WA 4KITB 5IP7J 1TT0A 2Q2EA 4GDFA 2NVUB 1TW3A 4EM0B 4A6EA 5F04A 2HZDA 1G2HA 5E3MA 4LG0B 3IV5A 1YW9A 2HYFA 3JSOA 2QYOA 3F9KA 4RB3C 3H9GA 1E3HA 4XLNF 2XSDC 3MKLA 2QLZA 4V2GA 3F6VA 4RAYA 2CUFA 1WI3A 1N78A 3QYEA 2V1NA 4U87A 1Z91A 3M07A 1K79A 2F5CA 3IHUA 3IKTA 5KNLA 3JREA 3F8NA 1YRNA 4DYCA 1JT0A 2XUBA 4E7LA 1BC7C 2ZNZA 4DQ2A 1TW2A 4EM1A 1FOXA 3CCYA 1XSDA 4HA8A 1ZARA 4JYKA 3BP8A 4LLGF 3CQZJ 3PNYA 3AFHA 5GPAA 3I59A 4XLAA 2VC1A 4E7IA 5FFXA 1U5TB 2XGXA 3OY9A 3A1YA 5K1YA 3ZGKA 1HKQA 2BHZA 2VODA 3HRMA 1BC8C 3PFYA 2AQFA 3F22A 3KP3A 3M4OJ 3DTKA 3M8FA 3MKZA 2QWWA 3D5RC 3F3XA 2QA4I 1ZELA 2LMDA 1ETOA 2DA1A 1NH3A 2DFEA 4UY8I 4BEHB 1W5CC 2EFPA 2ZJRF 1K7AA 1UELB 1IZ1A 4CH7A 1D3YA 3GW2A 3CD6I 3CC4I 2Z3YA 2NNYA 1A04A 2M5WA 3QP5A 2IGMA 3TKYA 2MLGA 1JUPA 3OS1A 5L3DA 2D1HA 1AOYA 3LSRA 1U9OA 1CF7B 1F43A 1TBXA 2QQAA 4PGHA 2X6OA 3EYYA 4MIMA 3E3VA 3CTAA 4G94A 5IP9J 2CUEA 2PBIA 5BNGA 1ITYA 5TJJA 3DU5A 3G73A 3CMAI 1UHWA 3A01B 2HDWA 2WV1A 5E79C 2EV5A 2R5ZA 2EB7A 4WXHA 5J6XA 5C4JJ 4L5JA 1PP8F 3CLOA 4JX5A 1JUSA 1KONA 2Z1DA 2HOTA 4UUSB 2COMA 2X1CA 3H35A 2NOGA 1P92A 4HAMA 2ZCWA 3WGIA 4X6AJ 3ZMZA 3H5NA 1JKQC 2IP2A 3LSIA 3OYBA 1FC3A 1YI2I 2ZKZA 1YOVB 5BS6A 4I0BA 4D1QA 1O4XA 3VSLA 2Y48A 1MJAA 3K4CA 3S1NJ 2IW5A 1ZH5A 1QHGA 4CCLA 4PJLA 1K6OA 4MEXF 2A68F 3G1OA 1O3RA 5C44J 3IAS2 1F36A 2ZSHB 4S0HB 4HLXA 4U88A 5GPCA 2IRFG 1WPKA 2E60A 3HG9A 4HV6A 2CWEA 3DBLB 3UKGA 2F5EA 4JQFA 2O8XA 2OBPA 1BR2A 1WH7A 3OV8A 1HW2A 1FP1D 3HDDA 2RREA 2LYCA 3DF8A 2E36A 3OSGA 2EK5A 1B8IB 4UVBA 4ZJZA 2HDCA 4CZZA 1O57A 4TV7A 4X1EA 2EBIA 2FRHA 4DOZA 2HYJA 2CG4A 1N75A 1FT9A 1IRFA 2NS7A 2E7WA 2FMLA 5HLHA 1PVEA 2PMZA 1D1CA 3A2KA 1QGPA 1D0YA 1TWCJ 4EGZA 3PO2J 2DQLA 4WK8F 3VDXA 2WADA 5M3MJ 4AUXA 2GOMA 4EJUA 2ESNA 2MBFA 2R7SA 1RI7A 2FJ1A 3BTLA 4KICA 2JWTA 5HDNA 2JPCA 2V6CA 2VI6A 3CJNA 3PUFA 3BLYA 5C3EJ 1J7KA 4MO7A 3DP7A 2M0MA 2XGDA 2M7AA 3CC7I 2IPQX 3HRSA 1V3FA 3HUGB 4AVZA 1ZRDA 5LEKA 1T56A 3WTXC 3N4MA 2HEOA 3OYCA 2NRAC 4XBFA 1HLVA 4KISA 2EINH 2KIQA 1SC7A 3L09A 1LDKB 2FX0A 1BI3A 4P9UA 3REOA 3LSMA 5E18F 4WWCA 3AG3H 2E7XA 4PZJA 2LK2A 3ZQGA 3O6BB 3KPHA 2KKOA 1IG7A 1JE8A 3QAHA 1Q1VA 3RQIA 5ERIA 3ZMSA 4C9YA 2HKXA 2LY9A 4EJWA 4LMYA 2DDBA 3U1DA 4EATA 1L3LA 4A3CJ 2VC0A 1ACIA 4JK1X 2Y31A 3WU1B 1SFEA 3F21A 1ZHFA 1ZGJA 2ELHA 4K2EA 1YJ9I 1F5TA 1XB4A 2EZLA 2EFNA 4MLOA 3F23A 4ITVA 1G8XA 1QO0D 3ZRGA 2O03A 2L7ZA 2M4GA 6PAXA 1UMQA 5FRNA 4AC0A 3FISA 2PJRA 2H6CA 2IBDA 3HOZJ 2DBBA 4BUPA 3A0HC 1O3SA 2LDUA 4RAZA 2DFIA 4CYCA 1MGTA 3FXJA 1BA5A 5IT9Z 4LIUA 3H3VK 4XLEA 2Z9OA 1EH6A 5B66C 4Q48A 1ZK8A 4DZPA 4IHWA 2Y0MA 1S8NA 3KP4A 3HZJA 2K4BA 2MH2A 1RNLA 2XC7A 4HOBA 5ILVA 2JK3A 1ENHA 2XB0X 4ZC3A 3GTMJ 3K4NA 1G3WA 1ZRFA 2CFOA 2V1DA 1IAWA 4IHSA 4I98B 2X4HA 5L3FA 2RQQA 3K7AJ 3KE2A 2DOEA 2DT7B 2KJCA 3EDPA 2QBYB 2CSOA 2A07F 3PIOF 3TOBA 3V42A 3BTCA 2ME6A 3M1CA 1W7PD 4B43A 4AWXB 2P7VB 1Y56A 3E6CC 3CP8A 3I64A 4Y3OA 2DA4A 2VJIA 2F4MB 3IRQA 2CUZA 3DBRB 3ERMA 2WBMA 3WODF 3CCEI 2DPUA 4QIWN 3BG7A 4ZH4F 1TWAJ 4BAYA 3FXKA 1P4WA 2H8WA 2IT0A 2F5DA 3WTTC 2XAFA 4U7DA 1XSVA 5F1JA 1X3WB 2CU7A 3EYIA 4L0YB 1R9TJ 1Z6TA 5J8CA 2VJ5A 2DPDA 4HF1A 5AONA 2Q2EB 1W0UA 4ZYGA 5A2QK 5LD2C 1U78A 4A0YA 4JX6A 4IOAF 3BZCA 3OYDA 3HKZN 1GVJA 3T0YA 3P9CA 3QYBA 4P96A 3DBHB 4XMYA 2ISYA 3HSRA 1ZG5A 3KP2A 3LFUA 3ZQQA 3OYKA 1ONVA 4NUBA 1FZPB 1U5TC 2A3SA 2ZXHA 3J81K 1VZ0A 1Z21A 2KRFA 2Y9YA 2RNJA 2K3FA 5FKMA 3BQZA 5E17F 4UB8C 2AQEA 1IRGA 5CPRB 2VJ4A 3GFMA 1GXPA 2PI0A 2V4JC 2R7UA 4E7ZA 3HL2A 2FBHA 1JT6A 2A05A 3WHCA 1YRNB 3GLXA 3L00A 4A2UA 5BQTA 3B02A 3GWZA 3QU3A 3K69A 2ELKA 5HLGA 1SMTA 1ZYRF 2GAUA 2R7WA 4J19A 1PJRA 1I39A 2BV6A 3W6JB 4EVIA 1T2KA 2IGKA 3I59B 1MD0A 3BCAA 3NWSA 4DIQA 5DV5A 1R5ID 4OIRF 5LEJA 3FMSA 4ZZLA 1IXSB 3ZR8X 3BTJA 3PQJA 1BN5A 2UV1A 1ZTRA 2FBIA 2NS8A 2QVOA 4M6YA 3WG9A 4XRFA 5B1AH 1T0FA 2ID3A 2LC2A 2DFFA 2M8EA 2DMNA 4BEHA 4OIOF 1KQ0A 3JRIA 4Y7NJ 2FMYA 3EPZA 1WJBA 2LH9A 4C3IJ 3EUAA 2LTPA 5LLQA 3VYRB 5ICEA 2CUJA 4FX0A 4PJJA 3JRBA 3FZVA 1BI1A 4IVNA 3I55I 5IT3A 5D6FA 3RDIA 1UAAA 3K4MA 1YIOA 3WG7H 1CQTA 1R6RA 4EMSA 2EV6A 4HQMA 1JHFA 3PO3J 1KGSA 3HC7A 3C18A 5JHUA 4MFDA 3HOVJ 2YU3A 4KIBA 3HOWJ 3V7RA 1FSEA 1VTNC 3FM3A 4M71A 3PM1A 1IV6A 1G59A 1J5YA 2DDAA 1KU2A 2A6EF 4ENJA 1B9MA 3RPUA 1TQIA 2X6XA 2BOLA 1XDSA 4RAGA 3M8JA 3QU6A 3CCVI 2YX7A 5J4YA 3NEUA 1RR7A 4OOIA 1P4XA 3S32A 1D1AA 4M3BA 4ESFA 1LE8A 2X48A 4WX9A 1LQ1A 1XC5A 4KIGA 1VQPI 2QUFA 1FPQA 2QF7A 4U0VA 5CVUA 4AYBN 3WE2A 4BXUA 3QOEA 2BXYA 3VSKA 5HVQC 2A61A 4I2OA 1RPWA 1S72I 2NVTJ 5J1UA 2CJJA 3AL0C 2OQGA 4C3HJ 4PSXA 3PL8A 1F9NA 3JW4A 3RKWA 4BE0A 4G8XA 4F92B 1K4SA 4UXNA 1RR8C 3TO9A 5BPIA 3I9V2 1IDYA 2JN6A 3BZ6A 5F0CA 1JGGA 2JRTA 1ODDA 3B6CA 1ZGWA 2LF8A 1DGWY 5ILSA 5FLMJ 4HX4A 4Q47A 2EQRA 3FXRA 4BY1J 1S6LA 3J80K 2Q0OA 3G1MA 2L7MP 5DD4A 2DT5A 2VIXA 3BG3A 1UG2A 5E1XA 3Q0WA 3EQLF 2E2IJ 3RTRA 1QPMA 1XX5A 1FSHA 3LSKA 2E5ZA 4RAFA 3AG4H 3S2DJ 3LQQA 4A0ZA 2HQNA 3KEOA 3JRCA 2MLKA 3ZQIA 1AWCA 4BQAA 1FMWA 2A6TA 5M5YJ 2FQ4A 4YIIA 1ZKGA 2K7LA 2OCCH 5C4XJ 1P7IA 2L9SA 2NVQJ 3WU0A 1UCRA 4RM3A 3HOXJ 2ME0A 3HUGA 3WHBA 2A5WA 3DLLF 2BVLA 2D45A 1W7PA 4CZCA 4YG2F 5DTDA 1W5SA 2QENA 2IEKA 4C30A 1YITI 4XLHA 3OIOA 2PG4A 3W2WA 4BDZA 2HOAA 3KETA 2O0YA 3CMEI 3OIPA 4G7HF 1MMSA 4LK0F 4L9TA 4I6ZA 4CCOA 4L9JA 2KT0A 5GADJ 5D5VB 2HTJA 1BR1A 2CH0A 2FBKA 3H3ZA 1WJCA 4KUMA 1OMIA 1SFUA 4KMUX 4XM3A 3HBLA 2K3PA 3LSPA 3R0AA 4A0XA 3HOYJ 2DA7A 3VEPA 2CS3A 1KQ8A 3WTYC 9ANTA 3TGNA 1HW5A 2V79A 4L9NA 5IOYA 1MMNA 2BY2A 4B44A 2LF7A 2PX9A 1MJBA 5GAGJ 2LVSA 2LLKA 3E7LA 5DS9A 4EJVA 3KCCA 3H9QA 2K86A 5IYDJ 2XPVA 4BY7J 2EILH 1FTZA 2PJRB 3TDZC 3VYTB 4XLCA 3BZKA 3K0LA 4CYCB 4DYRA 4NBQA 2H1KA 2E1NA 2CV2A 2E19A 1I1SA 3S1RJ 2EIMH 2E34A 2R7XA 3R61A 3BR6A 3E1SA 5EF6A 2XVCA 4KT5C 4A3EJ 2BEOA 4IRHA 1S7EA 2KFDA 2LY2A 2JA8J 3OIQA 4BL0B 1H89C 1WGXA 4YIRX 1Y1WJ 4DBQA 2EA2A 3KP5A 1OISA 3NAUA 3HJEA 2Q8KA 3J7AY 1K78A 4ETSA 2NS0A 2ZXWH 2MSYA 5L3BA 4NC6A 2P4WA 1YX3A 2DMUA 4A69C 1A6QA 2HYGD 2W82A 4DYQA 2CMPA 3LSHA 5IP6A 2FSWA 5D5UB 3U21A 2WB1N 1SFXA 3VOEA 1S9HA 1XS9A 1JI8A 1E2XA 3HEFA 1BL0A 3ABTA 1OYIA 1XGOA 4RM2A 1LJ9A 3BPVA 2Z2SB 4IQ4A 2BHYA 3V8JA 3ECOA 5KVRA 2E2HJ 2OV7A 5LGUA 3RQ4A 2QEXI 5F1RA 1E3PA 3NARA 1PDNC 5D4SA 3K70C 2OTJI 3V8KA 4ZTFA 2JA2A 2VE9A 5ICFA 1ZAOA 1V5FA 2K9LA 3C2BA 5LRRA 1FBUA 4PSWA 3JAMZ 1GLNA 4QSHA 3V4GA 3GFIA 5F27A 4KT6A 4P9FA 3LWFA 4ANJA 4S05A 4E7JA 4ENMA 2XAHA 3HKZA 2ZXIA 4F91B 3NQOA 3F8FA 3ZMTA 3OYFA 1TQPA 2UZKA 3OYHA 1O3TA 3ZN1A 2UXNA 2ZFWA 4L9VA 2IS1A 4XRSA 3PIPF 2LKSA 5J40A 4GYGA 4BBRJ 1I3AA 4KN4X 3TDUC 5EGOA 2HXOA 2Z99A 4YFXF 5D4RA 3BDDA 3GTJJ 4XRMA 1IC8A 3RYPA 3DXJF 1FBQA 4M73A 3K1MA 3D5LA 5KK1A 2XGCA 1ETXA 2BY3A 5E1WA 1APLC 1IXRC 4RLFA 5M3FJ 2LSOA 4II3A 4V2FA 1IN7A 2E71A 3BR0A 3BR5A 4QLCU 1ETYA 2FF4A 3DV8A 3I54A 3ULQB 1X1PA 4HQEA 3P9IA 2WWYA 4U7BA 4MTEA 2GA1A 1OCRH 2JVGA 3OS2A 1BIAA 2BVMA 2IGNA 2GBYA 4CA0A 4BJTA 3RKXA 4I01A 4HSRA 3K4LA 3LA3A 3HGGA 5H6RA 4HDUA 2ZBKA 3GZNB 4A3MJ 4MNUA 3BG5A 3S93A 5LRSA 3W6VA 4R1HA 2XPUA 3RJPA 4IPAA 4D5CA 4P1WA 4I0AA 1TWFJ 4UUVA 5K7HA 1VI0A 5E1ZB 4RS8A 3J7YJ 1IW7F 4NNJA 4XQFA 5EYRA 1Z9CA 2VBWA 1K4TA 3ZMUA 2ZJQF 1SFOJ 3DU6A 1FYKA 3KP6A 4BKXA 1VQKI 3GTPJ 2Z33A 1OQYA 5H2FC 3BJOA 3UNGC 2IS4A 2HTSA 2XRNA 4Y4RA 5HLTA 4CCJA 4F3QA 2DOAA 5IYBJ 1TQMA 3HSFA 4HF0A 2DA2A 2DW4A 2NVYJ 4UV9A 3T1BA 3TMOA 1OYWA 3IC7A 1SANA 4Y15A 4RGRA 1UHMA 3ZMDA 2QKMB 2VBYA 2GXBA 3CMMA 3A4CA 4B4CA 3DEWA 3HXLA 2Z16A 5D8LB 2W7NA 2W48A 3ZQLA 1WQ2A 3EUHC 1LE8B 5JLXA 1RKWA 1JKPC 2ZB9A 3G3ZA 2OZUA 4PDKA 4L5EA 3LAPA 3VYSB 3SHFA 4G6DA 3IWFA 3ZPLA 4BACA 2CW7A 5J3LA 5J8FA 1SAXA 1W5TA 1X1BA 1QVTA 2MW8A 3SZPA 1UG0A 4G7ZF 1REPC 4F52A 4N4NB 4B09A 4ZYEA 4N4OB 1S5LC 2K4JA 5TGTA 2R7DA 4YELA 1Q1HA 2HXIA 1T6SA 3UR3C 2IA0A 2PQ8A 2IVMA 1P9QC 3EUHA 2OCEA 2BGCA 3Q3SA 2WC2A 3V8LA 3OWTA 2AXTC 3GXOA 4G12A 3TEDA 3DTIA 1ZR2A 2XF5A 3OOPA 1XGNA 3HHGA 4GYIA 3CCJI 1ZREA 3NWTA 3CZ6A 2L54A 2WY7Q 1JTXA 3SFIA 3D5SC 1W36C 2F5FA 3CCSI 1WCMJ 2RC4A 1Z77A 2X9DA 1AHDP 1TZLA 2DN0A 4AD9A 3GX4X 4RA2A 5CVVA 2HZTA 1U3EM 3AL0B 4Y17A 3MN2A 4H4KC 2G7HA 2GIVA 2BYVE 1TLHB 4XORA 3RKQA 2MD0A 2VJJA 5EEAA 2P6TA 2GQQA 1YJWI 3S2HJ 1H8AC 4IQJA 1QVUA 1OCOH 1WSUA 1STZA 3C2GA 4B48A 3MVPA 1DUXC 4IHYA 2HU9A 4ZDPA 2DMQA 3R60A 1DU0A 1E3OC 1XTAA 4CHUA 4UVCA 1OPCA 4MFEA 1SD6A 2MA3A 1PUEE 1YQAA 1JXSA 2HQRA 1H0MA 4KYWA 3GTOJ 1W7PB 3E0JB 2BBYA 1GDTA 2KMUA 5AIPA 3C3WA 4AIJA 1W1WE 4GCVA 3Q9VA 3ASNH 5CVJA 4EJOA 4EM2A 1H88C 2B0LA 4BH9A 3H0GJ 3SYTA 2JA5J 4Z6YA 1MMDA 2ZMEC 3GTGJ 3IH3A 4XKBA 5DUKA 1U0JA 4HG2A 3WTSC 1DU6A 3MZYA 4ON0A 3QQAA 1B6AA 1G3YA 1QZZA 1BW6A 3AAFA 2P5LC 4CCMA 4LGWA 4GRIA 2STWA 3PUBA 2RAEA 3JCUC 4IEJA 1BJZA 3I4NJ 3AG2H 4BQNA 1S29A 3OMYA 2X51A 5FGMA 2XHKA 5EEGA 3JSPA 5LHGA 4RB1A 4U0YA 4C2TA 2FXAA 2ZMEA 1R22A 3BT9A 3TO7A 3FF5A 4CDGA 1B1BA 3IH2A 2KRHA 1T39A 3KFWX 4ESJA 1JHHA 3CF2A 4BU2A 2W84A 3I58A 4JP0A 1OYYA 5HNFA 1XD7A 3C7JA 4PJ0C 3HPHA 1Y1VJ 4L18B 3GF2A 1NHAA 5LHIA 1TWGJ 2BY0A 3O8GA 1AA7A 2WAFA 3K4BA 3HHHA 3E5UA 1FBSA 2ADUA 2OQRA 3ABKH 1K78B 2XKOA 2HOSA 3IRRA 3L2RA 2VKDA 2PN6A 4XK4A 4XICA 2MYSA 1WH5A 5FKLA 4E6KG 1F1ZA 3E6DA 3K9TA 2XF6A 4PUSA 2EZKA 2OPTA 1XG1A 2A69F 3DKXA 1H9TA 2UUZA 1OCCH 2XDVA 3FKIJ 1I3QJ 3FBIB 3MWMA 2CV1A 3X2QH 3FM5A 1D1BA 4YFNF 1WRJA 4HX8A 4OMYA 2FA5A 2L2OA 3FHZA 3VODA 1FTTA 2GLOA 1HSJA 3MMYB 1LKXA 5ED4A 2FEZA 4BDYA 3L2VA 1YJNI 4BQOA 3TBIA 2HR3A 3BG9A 4BHBA 2YS9A 1K83J 3PJRA 3Q0UA 5F0FA 3BJ6A 2R7OA 1W4MA 3MZ8A 4HNTA 5L3EA 1LEBA 2VT3A 3Q9SA 5FD5A 2D2WA 2ESHA 4A3LJ 1X1AA 2ETHA 1VQNI 1B9NA 4JX4A 4A3FJ 4EJTA 2XAUA 3CC2I 2AO9A 1YLFA 1RKTA 3BY6A 2JJ7A 2FOKA 3VFZA 2OD5A 4PJNA 5LBQA 5F64A 2LOOA 2RKHA 4LFUA 4B8XA 2PJPA 2TCTA 2FD5A 5EJCA 2DFHA 2VQCA 3ASOH 3U9GA 1TC3C 4ZYAA 3ZOBA 2VN2A 5EGOB 1SD5A 1TTYA 3KLNA 5DM7F 1IXCA 1FY7A 1KQ9A 2RGVA 4IHTA 2IA1A 3LSGA 2E1MC 1FWZA 4E4HA 1T0FC 4OINF 1JUMA 3WTWC 2P7CB 3V7CA 1BR4A 1R4NB 5CJ9A 5M5XJ 1RUOA 2O8KA 2I5UA 2VPRA 2KQRA 3F6OA 5DCFA 5DCMA 3OOUA 2VQGA 2DU9A 2RV8A 3S8PA 4IJAA 1I6XA 3OSFA 1RUNA 3OYLA 2X1DA 4OMZA 1WVRA 1FMVA 3CUOA 2ZO4A 4M6VA 1SVMA 1D8KA 2OZ6A 1F4KA 4L5IA 2EIJH 2YPRA 3LSJA 3I5UA 2DJNA 1W0TA 3L9FA 2W25A 4FHTA 3WGHA 5HS7A 2K02A 1J9IA 2EZIA 2P5VA 4I76A 1BOAA 4A5NA 2VOOA 1Y8RB 2X6YA 3TQNA 5J4VA 2O5RA 2V9PA 1V5GA 2ZSIB 1MBJA 2HPMA 2B9SA 2JUCA 5B5EC 1SEUA 3M7GA 2KP6A 1R1TA 1MBGA 3BR2A 1JJ8C 5BPDA 1EH8A 3I3LA 1ZLKA 1D5VA 2CQXA 3JRFA 4FTHA 5EG0A 1EA3A 2KLOA 1ZLJA 2GOXB 5D5WB 1YHQI 3B73A 2E35A 3W3CA 2VPLA
chains in the Genus database with same CATH topology
1F43A 3RZDJ 2DMPA 2E19A 3S1RJ 3JRDA 3BR6A 5EF6A 3S17J 2Y30A 4A3EJ 2X6OA 1S7EA 2JA8J 4MIMA 1POGA 4QTRA 1H89C 1WGXA 1Y1WJ 4M3EA 5IP9J 2CUEA 5BNGA 4A3BJ 3NAUA 1ITYA 3TP3A 2O9LA 3S14J 2MSYA 2Y0SN 2DMUA 4A69C 1EF4A 1Z0XA 2HQ5A 3A01B 2WV1A 2R5ZA 4M3GA 4DYQA 5C4JJ 5IP6A 1A6IA 4JX5A 1JUSA 2WB1N 3QPSA 2HOTA 4FE7A 4UUSB 2DTZA 2R93J 2NOGA 3ZQFA 2K9SA 1XS9A 1HCRA 4X6AJ 3HB9A 3FIWA 3HEFA 4Y52J 1BL0A 3TP0A 1JKQC 1AU7A 1P7JA 2ECCA 2GM4A 1PUFA 2R5YB 2OF7A 2R92J 3HGYA 3CMYA 1AKHB 3O8HA 4RDUA 1IRZA 2E2HJ 1O4XA 3HOUJ 3S1NJ 4ABZA 1MBHA 3G1OA 5C44J 1MH3A 4C2MJ 2XGEA 1F36A 4S0HB 3ZQCA 1U9NA 5GPCA 1WPKA 3NARA 4B1RA 3JR9A 3UKGA 2M9HA 1ETKA 1WH7A 3C2BA 3GBGA 3HDDA 4QSHA 1MSFC 1B8IB 4XIDA 3OSGA 2JA7J 5F27A 4FISA 5JLWA 5IYCJ 4X1EA 2EBIA 2HYJA 2M0CA 4XRSA 3QPLA 2NS7A 4W97A 4EEFG 1UHSA 4IHVA 4BBRJ 1TWCJ 5EGOA 2HXOA 3GTJJ 3PO2J 1IC8A 4XRMA 5M3MJ 4AUXA 1NTCA 2FJ1A 3BTLA 2L7FP 2JWTA 4BBSJ 2XGCA 1ETXA 2VI6A 5C3EJ 1APLC 3SJMA 4MO7A 1OJLA 2XGDA 2Y2ZA 5M3FJ 5E3NA 3DCFA 1T56A 1FIAA 4V2FA 3BR0A 3BR5A 1ETYA 1NK2P 1HLVA 3L1PA 5IPAA 2FX0A 3BQYA 5F08A 4D7NA 4A3JJ 2GBYA 2Y9ZA 2LK2A 3HGGA 2NVXJ 3ZQGA 2ID6A 1JKOC 5F0HA 4W1UA 4A3MJ 3BG5A 2AHQA 1IG7A 1Q1VA 3W6VA 3RQIA 2XPUA 4D5CA 2LY9A 5EZHA 1TWFJ 4A3CJ 5K7HA 1VI0A 2Y31A 4NDLA 2B63J 3FK7A 5EYRA 1VFCA 2EZLA 2VKVA 2EZHA 1SFOJ 1JKRC 4MLOA 3BR3A 5EDNA 3S16J 2L7ZA 4BKXA 3GTPJ 1MBEA 1LFBA 1UMQA 2E1OA 4AC0A 3FISA 4B3AA 2LKXA 3HOZJ 2IBDA 5IYBJ 2DA2A 2NVYJ 1U8BA 3S15J 1SANA 4CYCA 1BA5A 2VKEA 3H3VK 4D7MA 4B4CA 3DEWA 1ZK8A 4DZPA 4IHWA 3VPRA 1I50J 2W48A 3ZQLA 1LE8B 5JLXA 1RKWA 1JKPC 1TWHJ 1NK3P 2JK3A 1ENHA 2ZB9A 2LR8A 2XB0X 3TW7A 1I6HJ 4L5EA 3GTMJ 1RETA 1ORKA 1T33A 3A01A 3BTIA 2K9QA 1FEXA 1D5YA 5J3LA 1GV2A 3JRHA 2MGQA 2R5ZB 3JRGA 1QVTA 2MW8A 1OCTC 2L9RA 4UUSA 3K7AJ 3RZOJ 4HNVA 1QRYA 2R0QC 2KDZA 3ZQHA 5FJ8J 1X58A 2DMTA 2R5YA 2M34A 2HXIA 3BTCA 2ME6A 3BR1A 2QCOA 1AKHA 4C3JJ 2MG4A 3Q3SA 4A93J 5EZGA 2DA4A 3TEDA 4G12A 3K2AA 1ZR2A 1HOMA 4FE4A 2YUSA 1B72B 3D1NI 2JA6J 4QIWN 1TWAJ 1JTXA 1X2MA 3SFIA 5FKKA 4DZJA 1MSEC 2G0EA 5J1YA 1A5JA 1WCMJ 4A3GJ 1Z77A 2X9DA 5F1JA 2CU7A 1AHDP 1R9TJ 2DN0A 1K61A 1B8IA 3G1LA 1MNMC 1ETQA 3MN2A 1W0UA 3HM5A 2VUMJ 3RKQA 1U78A 4JX6A 5EEAA 2H8RA 5E3LA 4XRSG 3S2HJ 3HKZN 1HF0A 1H8AC 2E2JJ 1QVUA 3S1MJ 1ETVA 1GUUA 3MVPA 4IHYA 2K40A 2DMQA 2Y9YA 1DU0A 1E3OC 5FKMA 3BQZA 2PMZN 2D5VA 4MFEA 2M8GX 3GTOJ 1FIPA 1GDTA 1JT6A 3WHCA 1YRNB 2LD5A 3LNQA 2ELKA 1H88C 3H0GJ 1MBKA 4J19A 1IJWC 2JA5J 2R7ZJ 4A3KJ 3GTGJ 3IH3A 5GP9A 3SDGA 5M5WJ 1DU6A 2CRGA 2N8GA 1HDPA 3QQAA 1BW5A 1LFUP 1BW6A 2HDDA 1RESA 2XRLA 3BTJA 2IAIA 1ZTRA 2NS8A 2ECBA 2RAEA 4IEJA 1BJZA 3GTQJ 3I4NJ 2ID3A 2K9NA 2DMNA 5FKOA 2XPWA 4A3DJ 3JRIA 4Y7NJ 5J1RA 4M3DA 3JRAA 4RBOA 1IGNA 1QPIA 4IHXA 4C3IJ 2LTPA 5HODA 3JRBA 3BT9A 5EG0B 3IH2A 1OCPA 2TRTA 1CQTA 3F0CA 3FK6A 5E3OA 2LP0A 1MH4A 1JTYA 2M2EA 3PO3J 4UUTA 5K7ZA 1FJLA 4JP0A 4MFDA 2DA6A 3HOVJ 3GTLJ 3HOWJ 3PM1A 1IV6A 4LOCA 1Y1VJ 3CDLA 1GVDA 1TWGJ 3O8GA 1GT0C 2HOSA 5K7FA 4M3FA 1RR7A 5IOZA 4XK4A 4XICA 1WH5A 5FKLA 4DW6A 3M3YJ 4M3BA 1LE8A 2X48A 1XC5A 2EZKA 2OPTA 1XG1A 1JJ6C 4BXXJ 2QF7A 3Q0VA 4AYBN 2COBA 2P81A 3TW6A 3I4MJ 3FKIJ 1I3QJ 1PUFB 1RPWA 2NVTJ 4A3IJ 5J1UA 2CJJA 4C3HJ 1FTTA 2I10A 2GLOA 3S1QJ 5FLVA 1ZR4A 3BG9A 1IDYA 1ZQ3P 2YS9A 2JN6A 1K83J 3B6AA 4FCYA 5F0CA 1JGGA 3Q0UA 5F0FA 1B72A 4A3LJ 2EH3A 3B6CA 1GV5A 1ZGWA 4JX4A 5FLMJ 4A3FJ 1X2NA 2AO9A 2DA3A 1RKTA 2CQQA 2EQRA 2JJ7A 4BY1J 1ETWA 3G1MA 2L7MP 2YU9J 1EYFA 3BG3A 5IP7J 1UG2A 3Q0WA 2E2IJ 2TCTA 2FD5A 2DA5A 2WAQN 5F04A 1TC3C 3S2DJ 3ZOBA 5E3MA 3JRCA 1G2HA 1MBFA 3ZQIA 5EGOB 5M5YJ 3IV5A 1VF9A 3IH4A 2FQ4A 2O7OA 1ZKGA 2XSDC 3MKLA 5C4XJ 2XB5A 3LSGA 4V2GA 1P7IA 1HDDC 2NVQJ 2CUFA 1JUMA 3GTKJ 1WI3A 3A02A 2ME0A 3HOXJ 2L0KA 3LOCA 3WHBA 5M5XJ 2LFBA 2O8KA 3JREA 2VPRA 1YRNA 5DTDA 4DYCA 3OOUA 1JT0A 2IEKA 1ADNA 3OSFA 3CCYA 3OIOA 2HOAA 4M6VA 4I6ZA 4JYKA 2KT0A 1IDZA 4GFBA 3CQZJ 5GPAA 3LSJA 2DJNA 3A03A 1W0TA 1OFCX 3HBLA 5FKNA 3LSPA 3HOYJ 2EZIA 2DA7A 4I76A 9ANTA 5IOYA 1IUFA 2HI3A 3M4OJ 1MBJA 2LVSA 2LLKA 3E7LA 1ETOA 2DA1A 5DS9A 1VNDA 1MBGA 5IYDJ 2XPVA 4BY7J 2JMWA 3BR2A 1JJ8C 4D5FA 1FTZA 2CQXA 3JRFA 4FTHA 5EG0A 1JUPA 4CYCB 4DYRA 2H1KA 3LSRA 1U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F43 A;  3RZD J;  2DMP A;  2E19 A;  3S1R J;  3JRD A;  3BR6 A;  5EF6 A;  3S17 J;  2Y30 A;  4A3E J;  2X6O A;  1S7E A;  2JA8 J;  4MIM A;  1POG A;  4QTR A;  1H89 C;  1WGX A;  1Y1W J;  4M3E A;  5IP9 J;  2CUE A;  5BNG A;  4A3B J;  3NAU A;  1ITY A;  3TP3 A;  2O9L A;  3S14 J;  2MSY A;  2Y0S N;  2DMU A;  4A69 C;  1EF4 A;  1Z0X A;  2HQ5 A;  3A01 B;  2WV1 A;  2R5Z A;  4M3G A;  4DYQ A;  5C4J J;  5IP6 A;  1A6I A;  4JX5 A;  1JUS A;  2WB1 N;  3QPS A;  2HOT A;  4FE7 A;  4UUS B;  2DTZ A;  2R93 J;  2NOG A;  3ZQF A;  2K9S A;  1XS9 A;  1HCR A;  4X6A J;  3HB9 A;  3FIW A;  3HEF A;  4Y52 J;  1BL0 A;  3TP0 A;  1JKQ C;  1AU7 A;  1P7J A;  2ECC A;  2GM4 A;  1PUF A;  2R5Y B;  2OF7 A;  2R92 J;  3HGY A;  3CMY A;  1AKH B;  3O8H A;  4RDU A;  1IRZ A;  2E2H J;  1O4X A;  3HOU J;  3S1N J;  4ABZ A;  1MBH A;  3G1O A;  5C44 J;  1MH3 A;  4C2M J;  2XGE A;  1F36 A;  4S0H B;  3ZQC A;  1U9N A;  5GPC A;  1WPK A;  3NAR A;  4B1R A;  3JR9 A;  3UKG A;  2M9H A;  1ETK A;  1WH7 A;  3C2B A;  3GBG A;  3HDD A;  4QSH A;  1MSF C;  1B8I B;  4XID A;  3OSG A;  2JA7 J;  5F27 A;  4FIS A;  5JLW A;  5IYC J;  4X1E A;  2EBI A;  2HYJ A;  2M0C A;  4XRS A;  3QPL A;  2NS7 A;  4W97 A;  4EEF G;  1UHS A;  4IHV A;  4BBR J;  1TWC J;  5EGO A;  2HXO A;  3GTJ J;  3PO2 J;  1IC8 A;  4XRM A;  5M3M J;  4AUX A;  1NTC A;  2FJ1 A;  3BTL A;  2L7F P;  2JWT A;  4BBS J;  2XGC A;  1ETX A;  2VI6 A;  5C3E J;  1APL C;  3SJM A;  4MO7 A;  1OJL A;  2XGD A;  2Y2Z A;  5M3F J;  5E3N A;  3DCF A;  1T56 A;  1FIA A;  4V2F A;  3BR0 A;  3BR5 A;  1ETY A;  1NK2 P;  1HLV A;  3L1P A;  5IPA A;  2FX0 A;  3BQY A;  5F08 A;  4D7N A;  4A3J J;  2GBY A;  2Y9Z A;  2LK2 A;  3HGG A;  2NVX J;  3ZQG A;  2ID6 A;  1JKO C;  5F0H A;  4W1U A;  4A3M J;  3BG5 A;  2AHQ A;  1IG7 A;  1Q1V A;  3W6V A;  3RQI A;  2XPU A;  4D5C A;  2LY9 A;  5EZH A;  1TWF J;  4A3C J;  5K7H A;  1VI0 A;  2Y31 A;  4NDL A;  2B63 J;  3FK7 A;  5EYR A;  1VFC A;  2EZL A;  2VKV A;  2EZH A;  1SFO J;  1JKR C;  4MLO A;  3BR3 A;  5EDN A;  3S16 J;  2L7Z A;  4BKX A;  3GTP J;  1MBE A;  1LFB A;  1UMQ A;  2E1O A;  4AC0 A;  3FIS A;  4B3A A;  2LKX A;  3HOZ J;  2IBD A;  5IYB J;  2DA2 A;  2NVY J;  1U8B A;  3S15 J;  1SAN A;  4CYC A;  1BA5 A;  2VKE A;  3H3V K;  4D7M A;  4B4C A;  3DEW A;  1ZK8 A;  4DZP A;  4IHW A;  3VPR A;  1I50 J;  2W48 A;  3ZQL A;  1LE8 B;  5JLX A;  1RKW A;  1JKP C;  1TWH J;  1NK3 P;  2JK3 A;  1ENH A;  2ZB9 A;  2LR8 A;  2XB0 X;  3TW7 A;  1I6H J;  4L5E A;  3GTM J;  1RET A;  1ORK A;  1T33 A;  3A01 A;  3BTI A;  2K9Q A;  1FEX A;  1D5Y A;  5J3L A;  1GV2 A;  3JRH A;  2MGQ A;  2R5Z B;  3JRG A;  1QVT A;  2MW8 A;  1OCT C;  2L9R A;  4UUS A;  3K7A J;  3RZO J;  4HNV A;  1QRY A;  2R0Q C;  2KDZ A;  3ZQH A;  5FJ8 J;  1X58 A;  2DMT A;  2R5Y A;  2M34 A;  2HXI A;  3BTC A;  2ME6 A;  3BR1 A;  2QCO A;  1AKH A;  4C3J J;  2MG4 A;  3Q3S A;  4A93 J;  5EZG A;  2DA4 A;  3TED A;  4G12 A;  3K2A A;  1ZR2 A;  1HOM A;  4FE4 A;  2YUS A;  1B72 B;  3D1N I;  2JA6 J;  4QIW N;  1TWA J;  1JTX A;  1X2M A;  3SFI A;  5FKK A;  4DZJ A;  1MSE C;  2G0E A;  5J1Y A;  1A5J A;  1WCM J;  4A3G J;  1Z77 A;  2X9D A;  5F1J A;  2CU7 A;  1AHD P;  1R9T J;  2DN0 A;  1K61 A;  1B8I A;  3G1L A;  1MNM C;  1ETQ A;  3MN2 A;  1W0U A;  3HM5 A;  2VUM J;  3RKQ A;  1U78 A;  4JX6 A;  5EEA A;  2H8R A;  5E3L A;  4XRS G;  3S2H J;  3HKZ N;  1HF0 A;  1H8A C;  2E2J J;  1QVU A;  3S1M J;  1ETV A;  1GUU A;  3MVP A;  4IHY A;  2K40 A;  2DMQ A;  2Y9Y A;  1DU0 A;  1E3O C;  5FKM A;  3BQZ A;  2PMZ N;  2D5V A;  4MFE A;  2M8G X;  3GTO J;  1FIP A;  1GDT A;  1JT6 A;  3WHC A;  1YRN B;  2LD5 A;  3LNQ A;  2ELK A;  1H88 C;  3H0G J;  1MBK A;  4J19 A;  1IJW C;  2JA5 J;  2R7Z J;  4A3K J;  3GTG J;  3IH3 A;  5GP9 A;  3SDG A;  5M5W J;  1DU6 A;  2CRG A;  2N8G A;  1HDP A;  3QQA A;  1BW5 A;  1LFU P;  1BW6 A;  2HDD A;  1RES A;  2XRL A;  3BTJ A;  2IAI A;  1ZTR A;  2NS8 A;  2ECB A;  2RAE A;  4IEJ A;  1BJZ A;  3GTQ J;  3I4N J;  2ID3 A;  2K9N A;  2DMN A;  5FKO A;  2XPW A;  4A3D J;  3JRI A;  4Y7N J;  5J1R A;  4M3D A;  3JRA A;  4RBO A;  1IGN A;  1QPI A;  4IHX A;  4C3I J;  2LTP A;  5HOD A;  3JRB A;  3BT9 A;  5EG0 B;  3IH2 A;  1OCP A;  2TRT A;  1CQT A;  3F0C A;  3FK6 A;  5E3O A;  2LP0 A;  1MH4 A;  1JTY A;  2M2E A;  3PO3 J;  4UUT A;  5K7Z A;  1FJL A;  4JP0 A;  4MFD A;  2DA6 A;  3HOV J;  3GTL J;  3HOW J;  3PM1 A;  1IV6 A;  4LOC A;  1Y1V J;  3CDL A;  1GVD A;  1TWG J;  3O8G A;  1GT0 C;  2HOS A;  5K7F A;  4M3F A;  1RR7 A;  5IOZ A;  4XK4 A;  4XIC A;  1WH5 A;  5FKL A;  4DW6 A;  3M3Y J;  4M3B A;  1LE8 A;  2X48 A;  1XC5 A;  2EZK A;  2OPT A;  1XG1 A;  1JJ6 C;  4BXX J;  2QF7 A;  3Q0V A;  4AYB N;  2COB A;  2P81 A;  3TW6 A;  3I4M J;  3FKI J;  1I3Q J;  1PUF B;  1RPW A;  2NVT J;  4A3I J;  5J1U A;  2CJJ A;  4C3H J;  1FTT A;  2I10 A;  2GLO A;  3S1Q J;  5FLV A;  1ZR4 A;  3BG9 A;  1IDY A;  1ZQ3 P;  2YS9 A;  2JN6 A;  1K83 J;  3B6A A;  4FCY A;  5F0C A;  1JGG A;  3Q0U A;  5F0F A;  1B72 A;  4A3L J;  2EH3 A;  3B6C A;  1GV5 A;  1ZGW A;  4JX4 A;  5FLM J;  4A3F J;  1X2N A;  2AO9 A;  2DA3 A;  1RKT A;  2CQQ A;  2EQR A;  2JJ7 A;  4BY1 J;  1ETW A;  3G1M A;  2L7M P;  2YU9 J;  1EYF A;  3BG3 A;  5IP7 J;  1UG2 A;  3Q0W A;  2E2I J;  2TCT A;  2FD5 A;  2DA5 A;  2WAQ N;  5F04 A;  1TC3 C;  3S2D J;  3ZOB A;  5E3M A;  3JRC A;  1G2H A;  1MBF A;  3ZQI A;  5EGO B;  5M5Y J;  3IV5 A;  1VF9 A;  3IH4 A;  2FQ4 A;  2O7O A;  1ZKG A;  2XSD C;  3MKL A;  5C4X J;  2XB5 A;  3LSG A;  4V2G A;  1P7I A;  1HDD C;  2NVQ J;  2CUF A;  1JUM A;  3GTK J;  1WI3 A;  3A02 A;  2ME0 A;  3HOX J;  2L0K A;  3LOC A;  3WHB A;  5M5X J;  2LFB A;  2O8K A;  3JRE A;  2VPR A;  1YRN A;  5DTD A;  4DYC A;  3OOU A;  1JT0 A;  2IEK A;  1ADN A;  3OSF A;  3CCY A;  3OIO A;  2HOA A;  4M6V A;  4I6Z A;  4JYK A;  2KT0 A;  1IDZ A;  4GFB A;  3CQZ J;  5GPA A;  3LSJ A;  2DJN A;  3A03 A;  1W0T A;  1OFC X;  3HBL A;  5FKN A;  3LSP A;  3HOY J;  2EZI A;  2DA7 A;  4I76 A;  9ANT A;  5IOY A;  1IUF A;  2HI3 A;  3M4O J;  1MBJ A;  2LVS A;  2LLK A;  3E7L A;  1ETO A;  2DA1 A;  5DS9 A;  1VND A;  1MBG A;  5IYD J;  2XPV A;  4BY7 J;  2JMW A;  3BR2 A;  1JJ8 C;  4D5F A;  1FTZ A;  2CQX A;  3JRF A;  4FTH A;  5EG0 A;  1JUP A;  4CYC B;  4DYR A;  2H1K A;  3LSR A;  1U9O A; 
#chains in the Genus database with same CATH topology
 4IO9 F;  3S17 J;  2Y30 A;  3BOQ A;  2Y75 A;  3G4S I;  4ZDO A;  5FLX K;  1FOW A;  4A12 A;  1POG A;  2AS5 F;  4M3E A;  2ZNY A;  3OYA A;  5GAE J;  3J7A O;  1J2X A;  3TP3 A;  2L5Q A;  2XAS A;  3ROU A;  2QSH X;  3S14 J;  2L9N A;  2Y0S N;  4H0E A;  1DP7 P;  3EUK L;  1PP7 U;  4M6X A;  2R3S A;  2HQ5 A;  3KYL A;  3MQ0 A;  2F4O B;  2KHM A;  2DTR A;  1R23 A;  1R4M B;  2GA2 A;  3FWE A;  4E7H A;  2KJB A;  4CXF A;  4YEJ A;  3QPS A;  3FMR A;  1T98 A;  1MIJ A;  2PEX A;  3HRT A;  3ZQF A;  1HCR A;  2JQ7 A;  3HB9 A;  1NG7 A;  4DGW B;  3TP0 A;  3S2W A;  1AU7 A;  2F2E A;  2GM4 A;  2VXD A;  1PUF A;  4ESB A;  3ZMV A;  3HGY A;  3CMY A;  2XAG A;  3HIF A;  5J47 A;  1Z3X A;  3TO6 A;  4NHJ A;  4U0W A;  2L02 A;  4II2 A;  4ZZD A;  5IY5 H;  4LLL A;  4EQQ A;  5A2Q Z;  2HNH A;  3RYR A;  1EV7 A;  1GXQ A;  1MBH A;  2NOJ B;  3S3O A;  3JTH A;  2H27 A;  1MH3 A;  2VT2 A;  2VQL A;  2XGE A;  3WU2 C;  4CYD A;  5JI6 A;  3I53 A;  1U9N A;  3OYJ A;  1VQL I;  2K9M A;  5HNH A;  1VQM I;  1X1C A;  2A5Y B;  5LGT A;  1A35 A;  5HS8 A;  2R7V A;  1WJF A;  2M9H A;  1B4A A;  3E6B A;  2VXZ A;  5FRO A;  3GBG A;  2L4A A;  2IXS A;  2E5N A;  4XR6 A;  1V55 H;  3E5Q A;  4Y33 A;  4I02 A;  4IXA A;  3WTV C;  5FFZ A;  3F72 A;  2W4S A;  3KEQ A;  4FIS A;  3OS0 A;  3OYE A;  5JLW A;  3KEY A;  5IYC J;  3DFG A;  2ZJP F;  4ENN A;  4OIQ F;  2V7F A;  2M0C A;  5BMZ A;  4LD5 A;  3VYU B;  4EEF G;  1IN8 A;  3HTU A;  1WFX A;  2LY1 A;  4HX7 A;  4NQW A;  1Z6R A;  2A6H F;  2ELJ A;  2XAJ A;  4JOM A;  1G6N A;  3DPU A;  1BOB A;  2L7F P;  3OR2 C;  2VB6 A;  3K1P A;  4BBS J;  4UV8 A;  3L7W A;  1QBJ A;  2QSG X;  3GEZ A;  3DTE A;  4A6D A;  1OJL A;  2Y2Z A;  3OR1 C;  2QM3 A;  3H5A A;  1MMA A;  3DCF A;  1VQ9 I;  4UNO A;  2DQR A;  3DEE A;  4BHC A;  2JVH A;  1ZGA A;  4OIP F;  1UFM A;  5DD8 A;  3L1P A;  5IPA A;  3BQY A;  3LL7 A;  5F08 A;  4D7N A;  1TL8 A;  4A3J J;  5DYM A;  3C1D A;  1UJ8 A;  3DPT A;  1D0Z A;  2ID6 A;  1JKO C;  5B3S H;  4RGU A;  4W1U A;  2H94 A;  2AHQ A;  4M9Z A;  1KYZ A;  4JBA A;  4MQV A;  1FP2 A;  3O2P E;  2X1E A;  3FXL A;  2CYY A;  1IV8 A;  4LIT A;  2QKL B;  3WTU C;  4NDL A;  1UB9 A;  4FAS D;  1DP3 A;  2BE5 F;  4BGD A;  3HOT A;  3QPH A;  2EZH A;  1JKR C;  2ZME B;  2RDP A;  3BR3 A;  1ZRC A;  2WV0 A;  3IKV A;  5EDN A;  4PK4 A;  2HFH A;  4M74 A;  2EIK H;  3AG1 H;  4LK1 F;  2MAB A;  1GHC A;  4XON A;  2E1O A;  2QSF X;  4DBR A;  3S3M A;  2UWM A;  4B3A A;  1WI9 A;  2L4M A;  1BI2 A;  2LKX A;  5KCM A;  4MHG A;  3GUD A;  2ZJ2 A;  3S15 J;  1YFH A;  2M3A A;  1HC8 A;  3RIR A;  4UVA A;  1FOY A;  3WGG A;  1WJA A;  1Z05 A;  3N97 A;  2VKE A;  1LVA A;  2DLL A;  3KLO A;  3I0T A;  2XV4 S;  4D7M A;  2DO7 A;  3QRF F;  4XKW A;  1TT5 B;  1I50 J;  3BWG A;  4BJ5 C;  4R8H A;  3CJR B;  1KYW A;  2MD5 A;  1HXD A;  1TWH J;  1VQ7 I;  2LR8 A;  4LB6 B;  3TW7 A;  1G3T A;  1UST A;  1QNT A;  3BTI A;  1T08 B;  3FXO A;  5L3G A;  2K9Q A;  1A36 A;  4WCG A;  1GV2 A;  4I7H A;  3JRH A;  1R58 A;  4G9Y A;  2MGQ A;  4D0P A;  3JRG A;  2BY1 A;  1OCT C;  1KU9 A;  2L9R A;  4I99 C;  2R7R A;  3G71 I;  2KDZ A;  2DT6 A;  2OA4 A;  2FU4 A;  2R5Y A;  1WWX A;  2M34 A;  1O7F A;  3CJQ B;  3BR1 A;  2QCO A;  3J80 Z;  1AKH A;  1KZH A;  3M1E A;  3GVA A;  5GTI C;  2MG4 A;  4M72 A;  4A93 J;  2PMH A;  5EZG A;  4J01 A;  3M9A A;  2KDO A;  2CW0 F;  3ISP A;  2Q1Z B;  4FE4 A;  1TNS A;  2JRM A;  5CKT A;  1W36 D;  2M7B A;  3HPG A;  4FT8 A;  1DPU A;  3D1N I;  5E8I A;  1X3U A;  2J5P A;  5LHH A;  4KA4 A;  1QZY A;  4BE2 A;  3CUQ C;  5FKK A;  3SFZ A;  1KU7 A;  2G0E A;  5J1Y A;  4NC8 A;  4A3G J;  1O7L A;  2H09 A;  2JSC A;  4G6Q A;  1K61 A;  3G1L A;  1YW8 A;  2EPF A;  2RVC A;  2HVR A;  3CDI A;  3HM5 A;  3K4K A;  3KZY A;  4BYY A;  2E1C A;  2H8R A;  5E3L A;  3GME A;  2KZG A;  1HF0 A;  2MH9 A;  2JUG A;  1GUU A;  3FKJ A;  2NAZ A;  1H9G A;  3FXQ A;  2XF7 A;  2K40 A;  3GFJ A;  3BJA A;  2X6W A;  1Z7L A;  3KIO A;  4DJA A;  4O5V A;  1HBX G;  5HS9 A;  4ZTJ A;  1X4P A;  3CUQ A;  4N0B A;  1Z67 A;  3H92 A;  1LNW A;  2V9V A;  2DI3 A;  4WXD A;  4KNY A;  1FIP A;  2GZW A;  2KZV A;  3FXM A;  1YYV A;  5DCM B;  3MKY B;  3IWZ A;  4OAZ A;  4B47 A;  1USS A;  1HKT A;  3LNQ A;  2VBX A;  3FXU A;  2FQ3 A;  2NYX A;  1IJW C;  3R6S A;  2R7Z J;  5GP9 A;  1BIB A;  2ICW G;  3SDG A;  5M5W J;  1J09 A;  2VON A;  2BZT A;  4XLF A;  2CRG A;  2E1M B;  2N8G A;  4A5M A;  2JSP A;  2F6C A;  1OLT A;  1LFU P;  1NG6 A;  4XN3 A;  3GFL A;  2HDD A;  3BPX A;  1IRX A;  2M1B A;  1Y6I A;  3COA C;  1P2F A;  2ECB A;  1JGS A;  1QZE A;  2YSR A;  3GTQ J;  3LA7 A;  2FNA A;  4KN7 X;  2XPW A;  4A3D J;  4HV5 A;  3K10 A;  5J1R A;  1HKS A;  5JR3 A;  5H6Q A;  3CCR I;  2OAZ A;  1J59 A;  1QPI A;  4L0Z B;  1K6Y A;  4IHX A;  2Y69 H;  4IKF A;  2F4I A;  3KZI C;  1M1E B;  1MMG A;  2OU2 A;  4XOP A;  3E5X A;  2V9K A;  5HOD A;  1EJ9 A;  5K5O A;  2QZ8 A;  5EG0 B;  1OCP A;  1ULY A;  3U2R A;  2ISZ A;  4XSZ F;  3FK6 A;  4KJZ A;  4OAY A;  2LP0 A;  2OUM A;  1R1U A;  2PMU A;  3KX2 A;  5K7Z A;  1FJL A;  3GZ5 A;  2XAQ A;  3K4J A;  2DA6 A;  1DQU A;  4O3M A;  3P9K A;  3GTL J;  2DK8 A;  1LFP A;  1EH7 A;  2XIG A;  1T38 A;  3CDL A;  4IL6 C;  2CQK A;  3OYN A;  2Y0S A;  5DDG A;  5KAI C;  1GT0 C;  2DXI A;  3QPT A;  5TIS C;  4I09 A;  5K7F A;  4AYB A;  4M3F A;  5IOZ A;  3V7S A;  4OU0 A;  4DW6 A;  2ZC2 A;  2LRE A;  3K2Z A;  3H9J A;  3OYI A;  4C2U A;  3CJT B;  1WJD A;  2KIU A;  1TP4 A;  2RQP A;  1JJ6 C;  4BHP A;  4WF2 A;  3HYI A;  5LFA A;  3Q0V A;  4AU7 A;  5IT9 K;  1V5E A;  1RRJ A;  2O3F A;  2I8D A;  3I4M J;  2R7T A;  1HA8 A;  1OR7 C;  3PSF A;  5DEQ A;  4ZDL A;  1OCZ H;  4UHT A;  1MND A;  1PUF B;  2KL4 A;  3OL4 A;  4RLQ A;  2DOF A;  2HKO A;  3CP2 A;  2LKP A;  2VKH A;  3CCQ I;  3J7Z I;  1MDM A;  4G7O F;  3ELK A;  2I10 A;  1LDD A;  3OYM A;  5FLV A;  2G9W A;  1D0X A;  2QQ9 A;  1V54 H;  4HYE A;  3W2A A;  3MZH A;  3F8C A;  2HQA A;  1ZR4 A;  3O3K A;  1QHH D;  1WJ5 A;  1ZQ3 P;  2C6Y A;  4MGR A;  3B6A A;  4FCY A;  3R0J A;  5CYV A;  4CCN A;  1B72 A;  1R5H A;  1ZN2 A;  2EH3 A;  1GV5 A;  1OR7 A;  1S3J A;  1YTY A;  2O6G E;  2CQQ A;  2KRC A;  5CQE A;  1C0W A;  2CW8 A;  3PSI A;  4BE1 A;  2G7U A;  2DA5 A;  2WAQ N;  1X1D A;  2MFZ A;  2BW3 A;  1I27 A;  1MBF A;  4NQW B;  4IRI A;  4LB5 A;  4BQQ A;  1FX7 A;  4LLN A;  4N9H A;  1R49 A;  3OYG A;  1VF9 A;  1SVO A;  3IH4 A;  2XSJ C;  4F93 B;  4HNU A;  2O7O A;  3IP4 B;  2XB5 A;  1RIO H;  1HDD C;  2IS2 A;  2H6B A;  3GTK J;  3A02 A;  2EFO A;  2L0K A;  3LOC A;  4ZYD A;  2LFB A;  1XMX A;  3DQV C;  3PNT A;  3DEU A;  3PNV A;  1WJE A;  4HEA 2;  2QQB A;  1I1G A;  4OWR B;  1ADN A;  1QQI A;  3HSE A;  1MJ9 A;  2F48 A;  2NNN A;  4LIV A;  3SXY A;  4PJM A;  1IUY A;  4PFP A;  2JZY A;  3OL3 A;  1Y0N A;  3RPU D;  4X0G A;  1R1V A;  1IDZ A;  4GFB A;  1E17 A;  2V1X A;  3EET A;  5F6F A;  3A03 A;  1OFC X;  2LRD A;  2BXZ A;  2VE8 A;  5FKN A;  1YX5 A;  5JVG F;  1MKM A;  1YW7 A;  2W1O A;  2RNG A;  2M4K A;  4LG3 A;  1G3S A;  2Z5U A;  4BS9 A;  2F5V A;  2B7E A;  3GYH X;  1EKE A;  2JT1 A;  4YRV A;  1IUF A;  2HI3 A;  4HDV A;  2KIF A;  1UZC A;  1DDN A;  3TL4 X;  2CQN A;  4N9I A;  1VND A;  2JMW A;  2DAO A;  1ON1 A;  4D5F A;  5D6E A;  2WTE A;  3W6K B;  4CGZ A;  5AIQ A;  3H3U A;  2W85 A;  5ILU A;  2CV0 A;  1XN7 A;  3T5X A;  3N05 A;  2D5V A;  3RZO J;  5CVR A;  5JHF A;  4UB6 C;  2DMP A;  5DM6 F;  3AKZ A;  4AIK A;  3JRD A;  3RZD J;  3DPL C;  4IX7 A;  4IZZ A;  2DK5 A;  4QTR A;  1SVL A;  2JPB A;  2IA2 A;  5FRM A;  4E7K A;  4F7Z A;  4A3B J;  2WB1 A;  4MQ9 F;  5D8K B;  1CGP A;  2O9L A;  3GO5 A;  1O3Q A;  1EF4 A;  1SAU A;  2KPM A;  1Z0X A;  1R7J A;  2M30 A;  2WY8 Q;  2EJR A;  3F8B A;  4M3G A;  4NB5 A;  1VQ6 I;  1A6I A;  1YIJ I;  2EV0 A;  2VQH A;  4FE7 A;  1XDU A;  1Z3Y A;  2DTZ A;  3SEZ A;  2R93 J;  2K9S A;  3FIW A;  3ZXS A;  3HRU A;  4F55 A;  1SFK A;  3L2Q A;  4Y52 J;  1P7J A;  2ECC A;  3CF5 F;  1MNE A;  2R5Y B;  2L9V A;  2OF7 A;  1VQ4 I;  1X19 A;  1U2W A;  2R92 J;  2WA0 A;  1AKH B;  3O8H A;  4RDU A;  1KU3 A;  1IRZ A;  2KIS A;  3IAM 2;  2P8T A;  1VQ5 I;  3HOU J;  2GXG A;  5HDG A;  4ABZ A;  4EGY A;  2DYR H;  3I4P A;  3IL2 A;  2W00 A;  5CVI A;  4C2M J;  2LBF A;  1SD4 A;  3MCZ A;  3ZQC A;  4S04 A;  1B59 A;  1WKM A;  3ERE D;  4FQG A;  4G6T B;  4B1R A;  3JR9 A;  1X4O A;  3KYD B;  4MEY F;  1ETK A;  1LB2 A;  4XKV A;  3RSN A;  1DGR M;  3CES A;  5K5Q A;  4XID A;  1YO5 C;  1MSF C;  3A0B C;  1HW1 A;  4IOC F;  2UXX A;  2LG4 A;  1R36 A;  3ONQ A;  1YE9 A;  4XSX F;  2EFW A;  5FD6 A;  2MC4 A;  2HPI A;  3QPL A;  5JVT A;  4W97 A;  4QWQ A;  1XGM A;  5B1B H;  5TRD A;  1UHS A;  2WAE A;  4IHV A;  4R79 A;  3ESW B;  2ZFU A;  4LG0 A;  3CUQ B;  3PQK A;  2DOD A;  4NC7 A;  1NTC A;  1XGS A;  3CLQ A;  3KYC B;  4PCQ A;  5LGN A;  4ENK A;  1D8J A;  3CO6 C;  2PLY A;  3ABL H;  1Y39 A;  1BJA A;  5ICC A;  3GZ6 A;  4CUG A;  3SJM A;  2HOE A;  3CCM I;  2L3D A;  5E3N A;  4QPO A;  1FIA A;  3LQR A;  1OKR A;  4KMF A;  1IN5 A;  5FB2 A;  2R7Q A;  3ABM H;  2HVS A;  1FLI A;  4DNC A;  3ABU A;  1NK2 P;  2P5K A;  4HRI A;  3QOD A;  4GO1 A;  1Z7U A;  5K5R A;  1IN4 A;  2Y9Z A;  3G6E I;  3K6G A;  2NVX J;  1PYV A;  1ERD A;  4FET A;  2K85 A;  5F0H A;  1U5T A;  2PFB A;  1FNN A;  2VL8 A;  3DLA A;  4LJZ F;  5EZH A;  1IO2 A;  1Z1D A;  1Y8Q B;  3SEQ A;  2B63 J;  3FK7 A;  4XL9 A;  1VFC A;  1N77 A;  2YX4 A;  2VKV A;  2CO5 A;  1MZB A;  1P4A A;  3FBN B;  2HS5 A;  3S16 J;  2H1L A;  3MEX A;  1MBE A;  2EFQ A;  2IGO A;  3RCO A;  1LFB A;  2ZXJ A;  3T8R A;  3CO7 C;  3H5R A;  2FNP A;  2L7K A;  3M8E A;  3P5J A;  1U8B A;  3FX3 A;  1XMA A;  3RPQ A;  2XKP A;  3ML6 A;  3VWB A;  3P7N A;  4CSW A;  1CF7 A;  1WZ2 A;  4QPQ A;  1G4D A;  1LUJ B;  3K1N A;  4IF4 A;  4XKC A;  2MC3 A;  1J75 A;  1FOK A;  5GAH J;  4E70 A;  1XCB A;  5KAF C;  1YS6 A;  1ZG3 A;  3VPR A;  4M9X A;  4GXO A;  5ICG A;  1A31 A;  4FX4 A;  3MFK A;  4CIC A;  5H20 A;  1NK3 P;  3MD2 A;  5FO5 A;  4ASN A;  1I6H J;  1RET A;  1ORK A;  1T33 A;  4RGS A;  3A01 A;  1T8I A;  4AM3 A;  1LEA A;  1FEX A;  1D5Y A;  3JTG A;  2DJI A;  1LVK A;  3ZN0 A;  2R5Z B;  3SDB A;  3ZP5 A;  3W2V A;  3ECH A;  4UUS A;  4HNV A;  1QRY A;  2R0Q C;  1KA8 A;  2X0L A;  1HQC A;  2HWV A;  5CLS A;  3SZG A;  1BI0 A;  1XMK A;  3WTZ A;  1I5Z A;  1X58 A;  3ZQH A;  5FJ8 J;  2V1U A;  3K70 D;  4P55 A;  2DMT A;  3E97 A;  3ZCO A;  4XNF A;  4YIF A;  4MTD A;  1MDM B;  2M45 A;  1V4R A;  4AIH A;  4C3J J;  2LNB A;  3QOP A;  1ON2 A;  4EV0 A;  2OTL I;  2TDX A;  3H36 A;  2CGP A;  3K2A A;  1HOM A;  3J81 Z;  2IS6 A;  2YUS A;  1B72 B;  1LPQ A;  1HST A;  1VQ8 I;  2EWN A;  2JA6 J;  1WHU A;  5CQG A;  3KZZ A;  1X2M A;  3T8T A;  2CQ7 A;  2YR2 A;  3LA2 A;  3LST A;  2VBZ A;  3RI4 A;  3I71 A;  4DZJ A;  1MSE C;  1YS7 A;  3G2B A;  2ACJ A;  1A5J A;  4XOT A;  1U8R A;  2GXA A;  3R4K A;  4CO8 A;  3L2U A;  1FYM A;  3NRV A;  1LDJ A;  4WXC A;  2WAQ A;  1B8I A;  1MNM C;  1ETQ A;  4Y13 A;  2VUM J;  4V19 K;  2GWR A;  3F8M A;  1MW7 A;  2J5O A;  2BW3 B;  4XRS G;  1R00 A;  1IN6 A;  2E2J J;  2XRO A;  1ETV A;  3HOS A;  3S1M J;  3FMQ A;  4HLY A;  2K27 A;  3HTS B;  3IUO A;  3GLL A;  2PMZ N;  3L2C A;  3JAM K;  3KP7 A;  2M8G X;  2IJL A;  1P6R A;  4KDP A;  2EA4 A;  3SQN A;  2W24 A;  2QQ8 A;  2AXL A;  3QWL A;  4CCK A;  4Z2Y A;  5HDK A;  2LD5 A;  3VB2 A;  2FUG 2;  5HLI A;  2V6E A;  3U1K A;  1MBK A;  3I56 I;  1DPR A;  4A3K J;  2KIM A;  4ZYH A;  1FYL A;  2FOW A;  2STT A;  2M87 A;  3GCM A;  1HDP A;  1BW5 A;  2JA7 J;  2VAS A;  2V26 A;  4RGX A;  1TNT A;  3DWL E;  2HGC A;  4RB2 C;  1RES A;  2XRL A;  2IAI A;  1E0E A;  2DYS H;  4GGG A;  1BM9 A;  4HW0 A;  4BNC A;  4AID A;  1QU3 A;  2HVQ A;  2K9N A;  5FLX Z;  5FKO A;  2P6S A;  4M3D A;  3BCB A;  4HPQ A;  3JRA A;  5E8G A;  4D9J A;  4RBO A;  4J00 A;  1IGN A;  3BRO A;  3LAJ A;  1R5G A;  4AVP A;  3TOA A;  3CCL I;  4IRG A;  4BJ6 C;  3E6M A;  2R7F A;  5BOX A;  1VQO I;  4O6J A;  2TRT A;  3FHN A;  3H1C A;  3QYF A;  3F0C A;  5E3O A;  1SD7 A;  4E7S A;  5DUI A;  3LMM A;  2DCE A;  2L01 A;  1MH4 A;  1JTY A;  2M2E A;  4M9S A;  5HOO A;  4PGG A;  1ZG1 A;  2K5C A;  4UUT A;  1N25 A;  1SMY F;  3Q5F A;  3H0D A;  3BC8 A;  1S7O A;  4BXF A;  1S7A A;  2OJE D;  5JFR A;  4RB0 A;  2VLA A;  4LOC A;  1XPX A;  1GVD A;  2P0W A;  1R71 A;  3LFK A;  5D5X B;  2W57 A;  2RN7 A;  4PFO A;  3SZT A;  2X85 A;  5E20 A;  3M3Y J;  2QGU A;  3PFI A;  4XLP F;  3ZQ7 A;  1J0R A;  4BXX J;  2CFX A;  3RKY A;  1T95 A;  4KFC A;  2NXN B;  2O61 A;  4YFK F;  2COB A;  2P81 A;  5KHD A;  3TW6 A;  2JTV A;  3MKW B;  1RC9 A;  2VOP A;  2QBY A;  4A3I J;  4Q5S F;  2GIZ A;  5GTH C;  1IF1 A;  3CDH A;  3CCU I;  3S1Q J;  1XSX A;  2LBF B;  3C2H A;  4KIF A;  3S3N A;  2FE3 A;  4HF2 A;  2OC6 A;  3DKW A;  4HST A;  1QA6 A;  2R4G A;  2D1V A;  3MAJ A;  4Q4Z F;  1BBY A;  3DKY A;  3BG6 A;  3D0S A;  1XCV A;  1RZ4 A;  1YG2 A;  4XN0 A;  5EEH A;  4HZF A;  4B3X A;  4P5O A;  4HBL A;  3QP6 A;  4RMN A;  1X2N A;  2DA3 A;  5L3C A;  1U6G A;  1ETW A;  3FDY A;  2YU9 J;  1X3Z B;  1EYF A;  3WE3 A;  1L0O C;  1Y0U A;  3L2W A;  4KIT B;  5IP7 J;  1TT0 A;  2Q2E A;  4GDF A;  2NVU B;  1TW3 A;  4EM0 B;  4A6E A;  5F04 A;  2HZD A;  1G2H A;  5E3M A;  4LG0 B;  3IV5 A;  1YW9 A;  2HYF A;  3JSO A;  2QYO A;  3F9K A;  4RB3 C;  3H9G A;  1E3H A;  4XLN F;  2XSD C;  3MKL A;  2QLZ A;  4V2G A;  3F6V A;  4RAY A;  2CUF A;  1WI3 A;  1N78 A;  3QYE A;  2V1N A;  4U87 A;  1Z91 A;  3M07 A;  1K79 A;  2F5C A;  3IHU A;  3IKT A;  5KNL A;  3JRE A;  3F8N A;  1YRN A;  4DYC A;  1JT0 A;  2XUB A;  4E7L A;  1BC7 C;  2ZNZ A;  4DQ2 A;  1TW2 A;  4EM1 A;  1FOX A;  3CCY A;  1XSD A;  4HA8 A;  1ZAR A;  4JYK A;  3BP8 A;  4LLG F;  3CQZ J;  3PNY A;  3AFH A;  5GPA A;  3I59 A;  4XLA A;  2VC1 A;  4E7I A;  5FFX A;  1U5T B;  2XGX A;  3OY9 A;  3A1Y A;  5K1Y A;  3ZGK A;  1HKQ A;  2BHZ A;  2VOD A;  3HRM A;  1BC8 C;  3PFY A;  2AQF A;  3F22 A;  3KP3 A;  3M4O J;  3DTK A;  3M8F A;  3MKZ A;  2QWW A;  3D5R C;  3F3X A;  2QA4 I;  1ZEL A;  2LMD A;  1ETO A;  2DA1 A;  1NH3 A;  2DFE A;  4UY8 I;  4BEH B;  1W5C C;  2EFP A;  2ZJR F;  1K7A A;  1UEL B;  1IZ1 A;  4CH7 A;  1D3Y A;  3GW2 A;  3CD6 I;  3CC4 I;  2Z3Y A;  2NNY A;  1A04 A;  2M5W A;  3QP5 A;  2IGM A;  3TKY A;  2MLG A;  1JUP A;  3OS1 A;  5L3D A;  2D1H A;  1AOY A;  3LSR A;  1U9O A;  1CF7 B;  1F43 A;  1TBX A;  2QQA A;  4PGH A;  2X6O A;  3EYY A;  4MIM A;  3E3V A;  3CTA A;  4G94 A;  5IP9 J;  2CUE A;  2PBI A;  5BNG A;  1ITY A;  5TJJ A;  3DU5 A;  3G73 A;  3CMA I;  1UHW A;  3A01 B;  2HDW A;  2WV1 A;  5E79 C;  2EV5 A;  2R5Z A;  2EB7 A;  4WXH A;  5J6X A;  5C4J J;  4L5J A;  1PP8 F;  3CLO A;  4JX5 A;  1JUS A;  1KON A;  2Z1D A;  2HOT A;  4UUS B;  2COM A;  2X1C A;  3H35 A;  2NOG A;  1P92 A;  4HAM A;  2ZCW A;  3WGI A;  4X6A J;  3ZMZ A;  3H5N A;  1JKQ C;  2IP2 A;  3LSI A;  3OYB A;  1FC3 A;  1YI2 I;  2ZKZ A;  1YOV B;  5BS6 A;  4I0B A;  4D1Q A;  1O4X A;  3VSL A;  2Y48 A;  1MJA A;  3K4C A;  3S1N J;  2IW5 A;  1ZH5 A;  1QHG A;  4CCL A;  4PJL A;  1K6O A;  4MEX F;  2A68 F;  3G1O A;  1O3R A;  5C44 J;  3IAS 2;  1F36 A;  2ZSH B;  4S0H B;  4HLX A;  4U88 A;  5GPC A;  2IRF G;  1WPK A;  2E60 A;  3HG9 A;  4HV6 A;  2CWE A;  3DBL B;  3UKG A;  2F5E A;  4JQF A;  2O8X A;  2OBP A;  1BR2 A;  1WH7 A;  3OV8 A;  1HW2 A;  1FP1 D;  3HDD A;  2RRE A;  2LYC A;  3DF8 A;  2E36 A;  3OSG A;  2EK5 A;  1B8I B;  4UVB A;  4ZJZ A;  2HDC A;  4CZZ A;  1O57 A;  4TV7 A;  4X1E A;  2EBI A;  2FRH A;  4DOZ A;  2HYJ A;  2CG4 A;  1N75 A;  1FT9 A;  1IRF A;  2NS7 A;  2E7W A;  2FML A;  5HLH A;  1PVE A;  2PMZ A;  1D1C A;  3A2K A;  1QGP A;  1D0Y A;  1TWC J;  4EGZ A;  3PO2 J;  2DQL A;  4WK8 F;  3VDX A;  2WAD A;  5M3M J;  4AUX A;  2GOM A;  4EJU A;  2ESN A;  2MBF A;  2R7S A;  1RI7 A;  2FJ1 A;  3BTL A;  4KIC A;  2JWT A;  5HDN A;  2JPC A;  2V6C A;  2VI6 A;  3CJN A;  3PUF A;  3BLY A;  5C3E J;  1J7K A;  4MO7 A;  3DP7 A;  2M0M A;  2XGD A;  2M7A A;  3CC7 I;  2IPQ X;  3HRS A;  1V3F A;  3HUG B;  4AVZ A;  1ZRD A;  5LEK A;  1T56 A;  3WTX C;  3N4M A;  2HEO A;  3OYC A;  2NRA C;  4XBF A;  1HLV A;  4KIS A;  2EIN H;  2KIQ A;  1SC7 A;  3L09 A;  1LDK B;  2FX0 A;  1BI3 A;  4P9U A;  3REO A;  3LSM A;  5E18 F;  4WWC A;  3AG3 H;  2E7X A;  4PZJ A;  2LK2 A;  3ZQG A;  3O6B B;  3KPH A;  2KKO A;  1IG7 A;  1JE8 A;  3QAH A;  1Q1V A;  3RQI A;  5ERI A;  3ZMS A;  4C9Y A;  2HKX A;  2LY9 A;  4EJW A;  4LMY A;  2DDB A;  3U1D A;  4EAT A;  1L3L A;  4A3C J;  2VC0 A;  1ACI A;  4JK1 X;  2Y31 A;  3WU1 B;  1SFE A;  3F21 A;  1ZHF A;  1ZGJ A;  2ELH A;  4K2E A;  1YJ9 I;  1F5T A;  1XB4 A;  2EZL A;  2EFN A;  4MLO A;  3F23 A;  4ITV A;  1G8X A;  1QO0 D;  3ZRG A;  2O03 A;  2L7Z A;  2M4G A;  6PAX A;  1UMQ A;  5FRN A;  4AC0 A;  3FIS A;  2PJR A;  2H6C A;  2IBD A;  3HOZ J;  2DBB A;  4BUP A;  3A0H C;  1O3S A;  2LDU A;  4RAZ A;  2DFI A;  4CYC A;  1MGT A;  3FXJ A;  1BA5 A;  5IT9 Z;  4LIU A;  3H3V K;  4XLE A;  2Z9O A;  1EH6 A;  5B66 C;  4Q48 A;  1ZK8 A;  4DZP A;  4IHW A;  2Y0M A;  1S8N A;  3KP4 A;  3HZJ A;  2K4B A;  2MH2 A;  1RNL A;  2XC7 A;  4HOB A;  5ILV A;  2JK3 A;  1ENH A;  2XB0 X;  4ZC3 A;  3GTM J;  3K4N A;  1G3W A;  1ZRF A;  2CFO A;  2V1D A;  1IAW A;  4IHS A;  4I98 B;  2X4H A;  5L3F A;  2RQQ A;  3K7A J;  3KE2 A;  2DOE A;  2DT7 B;  2KJC A;  3EDP A;  2QBY B;  2CSO A;  2A07 F;  3PIO F;  3TOB A;  3V42 A;  3BTC A;  2ME6 A;  3M1C A;  1W7P D;  4B43 A;  4AWX B;  2P7V B;  1Y56 A;  3E6C C;  3CP8 A;  3I64 A;  4Y3O A;  2DA4 A;  2VJI A;  2F4M B;  3IRQ A;  2CUZ A;  3DBR B;  3ERM A;  2WBM A;  3WOD F;  3CCE I;  2DPU A;  4QIW N;  3BG7 A;  4ZH4 F;  1TWA J;  4BAY A;  3FXK A;  1P4W A;  2H8W A;  2IT0 A;  2F5D A;  3WTT C;  2XAF A;  4U7D A;  1XSV A;  5F1J A;  1X3W B;  2CU7 A;  3EYI A;  4L0Y B;  1R9T J;  1Z6T A;  5J8C A;  2VJ5 A;  2DPD A;  4HF1 A;  5AON A;  2Q2E B;  1W0U A;  4ZYG A;  5A2Q K;  5LD2 C;  1U78 A;  4A0Y A;  4JX6 A;  4IOA F;  3BZC A;  3OYD A;  3HKZ N;  1GVJ A;  3T0Y A;  3P9C A;  3QYB A;  4P96 A;  3DBH B;  4XMY A;  2ISY A;  3HSR A;  1ZG5 A;  3KP2 A;  3LFU A;  3ZQQ A;  3OYK A;  1ONV A;  4NUB A;  1FZP B;  1U5T C;  2A3S A;  2ZXH A;  3J81 K;  1VZ0 A;  1Z21 A;  2KRF A;  2Y9Y A;  2RNJ A;  2K3F A;  5FKM A;  3BQZ A;  5E17 F;  4UB8 C;  2AQE A;  1IRG A;  5CPR B;  2VJ4 A;  3GFM A;  1GXP A;  2PI0 A;  2V4J C;  2R7U A;  4E7Z A;  3HL2 A;  2FBH A;  1JT6 A;  2A05 A;  3WHC A;  1YRN B;  3GLX A;  3L00 A;  4A2U A;  5BQT A;  3B02 A;  3GWZ A;  3QU3 A;  3K69 A;  2ELK A;  5HLG A;  1SMT A;  1ZYR F;  2GAU A;  2R7W A;  4J19 A;  1PJR A;  1I39 A;  2BV6 A;  3W6J B;  4EVI A;  1T2K A;  2IGK A;  3I59 B;  1MD0 A;  3BCA A;  3NWS A;  4DIQ A;  5DV5 A;  1R5I D;  4OIR F;  5LEJ A;  3FMS A;  4ZZL A;  1IXS B;  3ZR8 X;  3BTJ A;  3PQJ A;  1BN5 A;  2UV1 A;  1ZTR A;  2FBI A;  2NS8 A;  2QVO A;  4M6Y A;  3WG9 A;  4XRF A;  5B1A H;  1T0F A;  2ID3 A;  2LC2 A;  2DFF A;  2M8E A;  2DMN A;  4BEH A;  4OIO F;  1KQ0 A;  3JRI A;  4Y7N J;  2FMY A;  3EPZ A;  1WJB A;  2LH9 A;  4C3I J;  3EUA A;  2LTP A;  5LLQ A;  3VYR B;  5ICE A;  2CUJ A;  4FX0 A;  4PJJ A;  3JRB A;  3FZV A;  1BI1 A;  4IVN A;  3I55 I;  5IT3 A;  5D6F A;  3RDI A;  1UAA A;  3K4M A;  1YIO A;  3WG7 H;  1CQT A;  1R6R A;  4EMS A;  2EV6 A;  4HQM A;  1JHF A;  3PO3 J;  1KGS A;  3HC7 A;  3C18 A;  5JHU A;  4MFD A;  3HOV J;  2YU3 A;  4KIB A;  3HOW J;  3V7R A;  1FSE A;  1VTN C;  3FM3 A;  4M71 A;  3PM1 A;  1IV6 A;  1G59 A;  1J5Y A;  2DDA A;  1KU2 A;  2A6E F;  4ENJ A;  1B9M A;  3RPU A;  1TQI A;  2X6X A;  2BOL A;  1XDS A;  4RAG A;  3M8J A;  3QU6 A;  3CCV I;  2YX7 A;  5J4Y A;  3NEU A;  1RR7 A;  4OOI A;  1P4X A;  3S32 A;  1D1A A;  4M3B A;  4ESF A;  1LE8 A;  2X48 A;  4WX9 A;  1LQ1 A;  1XC5 A;  4KIG A;  1VQP I;  2QUF A;  1FPQ A;  2QF7 A;  4U0V A;  5CVU A;  4AYB N;  3WE2 A;  4BXU A;  3QOE A;  2BXY A;  3VSK A;  5HVQ C;  2A61 A;  4I2O A;  1RPW A;  1S72 I;  2NVT J;  5J1U A;  2CJJ A;  3AL0 C;  2OQG A;  4C3H J;  4PSX A;  3PL8 A;  1F9N A;  3JW4 A;  3RKW A;  4BE0 A;  4G8X A;  4F92 B;  1K4S A;  4UXN A;  1RR8 C;  3TO9 A;  5BPI A;  3I9V 2;  1IDY A;  2JN6 A;  3BZ6 A;  5F0C A;  1JGG A;  2JRT A;  1ODD A;  3B6C A;  1ZGW A;  2LF8 A;  1DGW Y;  5ILS A;  5FLM J;  4HX4 A;  4Q47 A;  2EQR A;  3FXR A;  4BY1 J;  1S6L A;  3J80 K;  2Q0O A;  3G1M A;  2L7M P;  5DD4 A;  2DT5 A;  2VIX A;  3BG3 A;  1UG2 A;  5E1X A;  3Q0W A;  3EQL F;  2E2I J;  3RTR A;  1QPM A;  1XX5 A;  1FSH A;  3LSK A;  2E5Z A;  4RAF A;  3AG4 H;  3S2D J;  3LQQ A;  4A0Z A;  2HQN A;  3KEO A;  3JRC A;  2MLK A;  3ZQI A;  1AWC A;  4BQA A;  1FMW A;  2A6T A;  5M5Y J;  2FQ4 A;  4YII A;  1ZKG A;  2K7L A;  2OCC H;  5C4X J;  1P7I A;  2L9S A;  2NVQ J;  3WU0 A;  1UCR A;  4RM3 A;  3HOX J;  2ME0 A;  3HUG A;  3WHB A;  2A5W A;  3DLL F;  2BVL A;  2D45 A;  1W7P A;  4CZC A;  4YG2 F;  5DTD A;  1W5S A;  2QEN A;  2IEK A;  4C30 A;  1YIT I;  4XLH A;  3OIO A;  2PG4 A;  3W2W A;  4BDZ A;  2HOA A;  3KET A;  2O0Y A;  3CME I;  3OIP A;  4G7H F;  1MMS A;  4LK0 F;  4L9T A;  4I6Z A;  4CCO A;  4L9J A;  2KT0 A;  5GAD J;  5D5V B;  2HTJ A;  1BR1 A;  2CH0 A;  2FBK A;  3H3Z A;  1WJC A;  4KUM A;  1OMI A;  1SFU A;  4KMU X;  4XM3 A;  3HBL A;  2K3P A;  3LSP A;  3R0A A;  4A0X A;  3HOY J;  2DA7 A;  3VEP A;  2CS3 A;  1KQ8 A;  3WTY C;  9ANT A;  3TGN A;  1HW5 A;  2V79 A;  4L9N A;  5IOY A;  1MMN A;  2BY2 A;  4B44 A;  2LF7 A;  2PX9 A;  1MJB A;  5GAG J;  2LVS A;  2LLK A;  3E7L A;  5DS9 A;  4EJV A;  3KCC A;  3H9Q A;  2K86 A;  5IYD J;  2XPV A;  4BY7 J;  2EIL H;  1FTZ A;  2PJR B;  3TDZ C;  3VYT B;  4XLC A;  3BZK A;  3K0L A;  4CYC B;  4DYR A;  4NBQ A;  2H1K A;  2E1N A;  2CV2 A;  2E19 A;  1I1S A;  3S1R J;  2EIM H;  2E34 A;  2R7X A;  3R61 A;  3BR6 A;  3E1S A;  5EF6 A;  2XVC A;  4KT5 C;  4A3E J;  2BEO A;  4IRH A;  1S7E A;  2KFD A;  2LY2 A;  2JA8 J;  3OIQ A;  4BL0 B;  1H89 C;  1WGX A;  4YIR X;  1Y1W J;  4DBQ A;  2EA2 A;  3KP5 A;  1OIS A;  3NAU A;  3HJE A;  2Q8K A;  3J7A Y;  1K78 A;  4ETS A;  2NS0 A;  2ZXW H;  2MSY A;  5L3B A;  4NC6 A;  2P4W A;  1YX3 A;  2DMU A;  4A69 C;  1A6Q A;  2HYG D;  2W82 A;  4DYQ A;  2CMP A;  3LSH A;  5IP6 A;  2FSW A;  5D5U B;  3U21 A;  2WB1 N;  1SFX A;  3VOE A;  1S9H A;  1XS9 A;  1JI8 A;  1E2X A;  3HEF A;  1BL0 A;  3ABT A;  1OYI A;  1XGO A;  4RM2 A;  1LJ9 A;  3BPV A;  2Z2S B;  4IQ4 A;  2BHY A;  3V8J A;  3ECO A;  5KVR A;  2E2H J;  2OV7 A;  5LGU A;  3RQ4 A;  2QEX I;  5F1R A;  1E3P A;  3NAR A;  1PDN C;  5D4S A;  3K70 C;  2OTJ I;  3V8K A;  4ZTF A;  2JA2 A;  2VE9 A;  5ICF A;  1ZAO A;  1V5F A;  2K9L A;  3C2B A;  5LRR A;  1FBU A;  4PSW A;  3JAM Z;  1GLN A;  4QSH A;  3V4G A;  3GFI A;  5F27 A;  4KT6 A;  4P9F A;  3LWF A;  4ANJ A;  4S05 A;  4E7J A;  4ENM A;  2XAH A;  3HKZ A;  2ZXI A;  4F91 B;  3NQO A;  3F8F A;  3ZMT A;  3OYF A;  1TQP A;  2UZK A;  3OYH A;  1O3T A;  3ZN1 A;  2UXN A;  2ZFW A;  4L9V A;  2IS1 A;  4XRS A;  3PIP F;  2LKS A;  5J40 A;  4GYG A;  4BBR J;  1I3A A;  4KN4 X;  3TDU C;  5EGO A;  2HXO A;  2Z99 A;  4YFX F;  5D4R A;  3BDD A;  3GTJ J;  4XRM A;  1IC8 A;  3RYP A;  3DXJ F;  1FBQ A;  4M73 A;  3K1M A;  3D5L A;  5KK1 A;  2XGC A;  1ETX A;  2BY3 A;  5E1W A;  1APL C;  1IXR C;  4RLF A;  5M3F J;  2LSO A;  4II3 A;  4V2F A;  1IN7 A;  2E71 A;  3BR0 A;  3BR5 A;  4QLC U;  1ETY A;  2FF4 A;  3DV8 A;  3I54 A;  3ULQ B;  1X1P A;  4HQE A;  3P9I A;  2WWY A;  4U7B A;  4MTE A;  2GA1 A;  1OCR H;  2JVG A;  3OS2 A;  1BIA A;  2BVM A;  2IGN A;  2GBY A;  4CA0 A;  4BJT A;  3RKX A;  4I01 A;  4HSR A;  3K4L A;  3LA3 A;  3HGG A;  5H6R A;  4HDU A;  2ZBK A;  3GZN B;  4A3M J;  4MNU A;  3BG5 A;  3S93 A;  5LRS A;  3W6V A;  4R1H A;  2XPU A;  3RJP A;  4IPA A;  4D5C A;  4P1W A;  4I0A A;  1TWF J;  4UUV A;  5K7H A;  1VI0 A;  5E1Z B;  4RS8 A;  3J7Y J;  1IW7 F;  4NNJ A;  4XQF A;  5EYR A;  1Z9C A;  2VBW A;  1K4T A;  3ZMU A;  2ZJQ F;  1SFO J;  3DU6 A;  1FYK A;  3KP6 A;  4BKX A;  1VQK I;  3GTP J;  2Z33 A;  1OQY A;  5H2F C;  3BJO A;  3UNG C;  2IS4 A;  2HTS A;  2XRN A;  4Y4R A;  5HLT A;  4CCJ A;  4F3Q A;  2DOA A;  5IYB J;  1TQM A;  3HSF A;  4HF0 A;  2DA2 A;  2DW4 A;  2NVY J;  4UV9 A;  3T1B A;  3TMO A;  1OYW A;  3IC7 A;  1SAN A;  4Y15 A;  4RGR A;  1UHM A;  3ZMD A;  2QKM B;  2VBY A;  2GXB A;  3CMM A;  3A4C A;  4B4C A;  3DEW A;  3HXL A;  2Z16 A;  5D8L B;  2W7N A;  2W48 A;  3ZQL A;  1WQ2 A;  3EUH C;  1LE8 B;  5JLX A;  1RKW A;  1JKP C;  2ZB9 A;  3G3Z A;  2OZU A;  4PDK A;  4L5E A;  3LAP A;  3VYS B;  3SHF A;  4G6D A;  3IWF A;  3ZPL A;  4BAC A;  2CW7 A;  5J3L A;  5J8F A;  1SAX A;  1W5T A;  1X1B A;  1QVT A;  2MW8 A;  3SZP A;  1UG0 A;  4G7Z F;  1REP C;  4F52 A;  4N4N B;  4B09 A;  4ZYE A;  4N4O B;  1S5L C;  2K4J A;  5TGT A;  2R7D A;  4YEL A;  1Q1H A;  2HXI A;  1T6S A;  3UR3 C;  2IA0 A;  2PQ8 A;  2IVM A;  1P9Q C;  3EUH A;  2OCE A;  2BGC A;  3Q3S A;  2WC2 A;  3V8L A;  3OWT A;  2AXT C;  3GXO A;  4G12 A;  3TED A;  3DTI A;  1ZR2 A;  2XF5 A;  3OOP A;  1XGN A;  3HHG A;  4GYI A;  3CCJ I;  1ZRE A;  3NWT A;  3CZ6 A;  2L54 A;  2WY7 Q;  1JTX A;  3SFI A;  3D5S C;  1W36 C;  2F5F A;  3CCS I;  1WCM J;  2RC4 A;  1Z77 A;  2X9D A;  1AHD P;  1TZL A;  2DN0 A;  4AD9 A;  3GX4 X;  4RA2 A;  5CVV A;  2HZT A;  1U3E M;  3AL0 B;  4Y17 A;  3MN2 A;  4H4K C;  2G7H A;  2GIV A;  2BYV E;  1TLH B;  4XOR A;  3RKQ A;  2MD0 A;  2VJJ A;  5EEA A;  2P6T A;  2GQQ A;  1YJW I;  3S2H J;  1H8A C;  4IQJ A;  1QVU A;  1OCO H;  1WSU A;  1STZ A;  3C2G A;  4B48 A;  3MVP A;  1DUX C;  4IHY A;  2HU9 A;  4ZDP A;  2DMQ A;  3R60 A;  1DU0 A;  1E3O C;  1XTA A;  4CHU A;  4UVC A;  1OPC A;  4MFE A;  1SD6 A;  2MA3 A;  1PUE E;  1YQA A;  1JXS A;  2HQR A;  1H0M A;  4KYW A;  3GTO J;  1W7P B;  3E0J B;  2BBY A;  1GDT A;  2KMU A;  5AIP A;  3C3W A;  4AIJ A;  1W1W E;  4GCV A;  3Q9V A;  3ASN H;  5CVJ A;  4EJO A;  4EM2 A;  1H88 C;  2B0L A;  4BH9 A;  3H0G J;  3SYT A;  2JA5 J;  4Z6Y A;  1MMD A;  2ZME C;  3GTG J;  3IH3 A;  4XKB A;  5DUK A;  1U0J A;  4HG2 A;  3WTS C;  1DU6 A;  3MZY A;  4ON0 A;  3QQA A;  1B6A A;  1G3Y A;  1QZZ A;  1BW6 A;  3AAF A;  2P5L C;  4CCM A;  4LGW A;  4GRI A;  2STW A;  3PUB A;  2RAE A;  3JCU C;  4IEJ A;  1BJZ A;  3I4N J;  3AG2 H;  4BQN A;  1S29 A;  3OMY A;  2X51 A;  5FGM A;  2XHK A;  5EEG A;  3JSP A;  5LHG A;  4RB1 A;  4U0Y A;  4C2T A;  2FXA A;  2ZME A;  1R22 A;  3BT9 A;  3TO7 A;  3FF5 A;  4CDG A;  1B1B A;  3IH2 A;  2KRH A;  1T39 A;  3KFW X;  4ESJ A;  1JHH A;  3CF2 A;  4BU2 A;  2W84 A;  3I58 A;  4JP0 A;  1OYY A;  5HNF A;  1XD7 A;  3C7J A;  4PJ0 C;  3HPH A;  1Y1V J;  4L18 B;  3GF2 A;  1NHA A;  5LHI A;  1TWG J;  2BY0 A;  3O8G A;  1AA7 A;  2WAF A;  3K4B A;  3HHH A;  3E5U A;  1FBS A;  2ADU A;  2OQR A;  3ABK H;  1K78 B;  2XKO A;  2HOS A;  3IRR A;  3L2R A;  2VKD A;  2PN6 A;  4XK4 A;  4XIC A;  2MYS A;  1WH5 A;  5FKL A;  4E6K G;  1F1Z A;  3E6D A;  3K9T A;  2XF6 A;  4PUS A;  2EZK A;  2OPT A;  1XG1 A;  2A69 F;  3DKX A;  1H9T A;  2UUZ A;  1OCC H;  2XDV A;  3FKI J;  1I3Q J;  3FBI B;  3MWM A;  2CV1 A;  3X2Q H;  3FM5 A;  1D1B A;  4YFN F;  1WRJ A;  4HX8 A;  4OMY A;  2FA5 A;  2L2O A;  3FHZ A;  3VOD A;  1FTT A;  2GLO A;  1HSJ A;  3MMY B;  1LKX A;  5ED4 A;  2FEZ A;  4BDY A;  3L2V A;  1YJN I;  4BQO A;  3TBI A;  2HR3 A;  3BG9 A;  4BHB A;  2YS9 A;  1K83 J;  3PJR A;  3Q0U A;  5F0F A;  3BJ6 A;  2R7O A;  1W4M A;  3MZ8 A;  4HNT A;  5L3E A;  1LEB A;  2VT3 A;  3Q9S A;  5FD5 A;  2D2W A;  2ESH A;  4A3L J;  1X1A A;  2ETH A;  1VQN I;  1B9N A;  4JX4 A;  4A3F J;  4EJT A;  2XAU A;  3CC2 I;  2AO9 A;  1YLF A;  1RKT A;  3BY6 A;  2JJ7 A;  2FOK A;  3VFZ A;  2OD5 A;  4PJN A;  5LBQ A;  5F64 A;  2LOO A;  2RKH A;  4LFU A;  4B8X A;  2PJP A;  2TCT A;  2FD5 A;  5EJC A;  2DFH A;  2VQC A;  3ASO H;  3U9G A;  1TC3 C;  4ZYA A;  3ZOB A;  2VN2 A;  5EGO B;  1SD5 A;  1TTY A;  3KLN A;  5DM7 F;  1IXC A;  1FY7 A;  1KQ9 A;  2RGV A;  4IHT A;  2IA1 A;  3LSG A;  2E1M C;  1FWZ A;  4E4H A;  1T0F C;  4OIN F;  1JUM A;  3WTW C;  2P7C B;  3V7C A;  1BR4 A;  1R4N B;  5CJ9 A;  5M5X J;  1RUO A;  2O8K A;  2I5U A;  2VPR A;  2KQR A;  3F6O A;  5DCF A;  5DCM A;  3OOU A;  2VQG A;  2DU9 A;  2RV8 A;  3S8P A;  4IJA A;  1I6X A;  3OSF A;  1RUN A;  3OYL A;  2X1D A;  4OMZ A;  1WVR A;  1FMV A;  3CUO A;  2ZO4 A;  4M6V A;  1SVM A;  1D8K A;  2OZ6 A;  1F4K A;  4L5I A;  2EIJ H;  2YPR A;  3LSJ A;  3I5U A;  2DJN A;  1W0T A;  3L9F A;  2W25 A;  4FHT A;  3WGH A;  5HS7 A;  2K02 A;  1J9I A;  2EZI A;  2P5V A;  4I76 A;  1BOA A;  4A5N A;  2VOO A;  1Y8R B;  2X6Y A;  3TQN A;  5J4V A;  2O5R A;  2V9P A;  1V5G A;  2ZSI B;  1MBJ A;  2HPM A;  2B9S A;  2JUC A;  5B5E C;  1SEU A;  3M7G A;  2KP6 A;  1R1T A;  1MBG A;  3BR2 A;  1JJ8 C;  5BPD A;  1EH8 A;  3I3L A;  1ZLK A;  1D5V A;  2CQX A;  3JRF A;  4FTH A;  5EG0 A;  1EA3 A;  2KLO A;  1ZLJ A;  2GOX B;  5D5W B;  1YHQ I;  3B73 A;  2E35 A;  3W3C A;  2VPL A; 
#chains in the Genus database with same CATH homology
 1F43 A;  3RZD J;  2DMP A;  2E19 A;  3S1R J;  3JRD A;  3BR6 A;  5EF6 A;  3S17 J;  2Y30 A;  4A3E J;  2X6O A;  1S7E A;  2JA8 J;  4MIM A;  1POG A;  4QTR A;  1H89 C;  1WGX A;  1Y1W J;  4M3E A;  5IP9 J;  2CUE A;  5BNG A;  4A3B J;  3NAU A;  1ITY A;  3TP3 A;  2O9L A;  3S14 J;  2MSY A;  2Y0S N;  2DMU A;  4A69 C;  1EF4 A;  1Z0X A;  2HQ5 A;  3A01 B;  2WV1 A;  2R5Z A;  4M3G A;  4DYQ A;  5C4J J;  5IP6 A;  1A6I A;  4JX5 A;  1JUS A;  2WB1 N;  3QPS A;  2HOT A;  4FE7 A;  4UUS B;  2DTZ A;  2R93 J;  2NOG A;  3ZQF A;  2K9S A;  1XS9 A;  1HCR A;  4X6A J;  3HB9 A;  3FIW A;  3HEF A;  4Y52 J;  1BL0 A;  3TP0 A;  1JKQ C;  1AU7 A;  1P7J A;  2ECC A;  2GM4 A;  1PUF A;  2R5Y B;  2OF7 A;  2R92 J;  3HGY A;  3CMY A;  1AKH B;  3O8H A;  4RDU A;  1IRZ A;  2E2H J;  1O4X A;  3HOU J;  3S1N J;  4ABZ A;  1MBH A;  3G1O A;  5C44 J;  1MH3 A;  4C2M J;  2XGE A;  1F36 A;  4S0H B;  3ZQC A;  1U9N A;  5GPC A;  1WPK A;  3NAR A;  4B1R A;  3JR9 A;  3UKG A;  2M9H A;  1ETK A;  1WH7 A;  3C2B A;  3GBG A;  3HDD A;  4QSH A;  1MSF C;  1B8I B;  4XID A;  3OSG A;  2JA7 J;  5F27 A;  4FIS A;  5JLW A;  5IYC J;  4X1E A;  2EBI A;  2HYJ A;  2M0C A;  4XRS A;  3QPL A;  2NS7 A;  4W97 A;  4EEF G;  1UHS A;  4IHV A;  4BBR J;  1TWC J;  5EGO A;  2HXO A;  3GTJ J;  3PO2 J;  1IC8 A;  4XRM A;  5M3M J;  4AUX A;  1NTC A;  2FJ1 A;  3BTL A;  2L7F P;  2JWT A;  4BBS J;  2XGC A;  1ETX A;  2VI6 A;  5C3E J;  1APL C;  3SJM A;  4MO7 A;  1OJL A;  2XGD A;  2Y2Z A;  5M3F J;  5E3N A;  3DCF A;  1T56 A;  1FIA A;  4V2F A;  3BR0 A;  3BR5 A;  1ETY A;  1NK2 P;  1HLV A;  3L1P A;  5IPA A;  2FX0 A;  3BQY A;  5F08 A;  4D7N A;  4A3J J;  2GBY A;  2Y9Z A;  2LK2 A;  3HGG A;  2NVX J;  3ZQG A;  2ID6 A;  1JKO C;  5F0H A;  4W1U A;  4A3M J;  3BG5 A;  2AHQ A;  1IG7 A;  1Q1V A;  3W6V A;  3RQI A;  2XPU A;  4D5C A;  2LY9 A;  5EZH A;  1TWF J;  4A3C J;  5K7H A;  1VI0 A;  2Y31 A;  4NDL A;  2B63 J;  3FK7 A;  5EYR A;  1VFC A;  2EZL A;  2VKV A;  2EZH A;  1SFO J;  1JKR C;  4MLO A;  3BR3 A;  5EDN A;  3S16 J;  2L7Z A;  4BKX A;  3GTP J;  1MBE A;  1LFB A;  1UMQ A;  2E1O A;  4AC0 A;  3FIS A;  4B3A A;  2LKX A;  3HOZ J;  2IBD A;  5IYB J;  2DA2 A;  2NVY J;  1U8B A;  3S15 J;  1SAN A;  4CYC A;  1BA5 A;  2VKE A;  3H3V K;  4D7M A;  4B4C A;  3DEW A;  1ZK8 A;  4DZP A;  4IHW A;  3VPR A;  1I50 J;  2W48 A;  3ZQL A;  1LE8 B;  5JLX A;  1RKW A;  1JKP C;  1TWH J;  1NK3 P;  2JK3 A;  1ENH A;  2ZB9 A;  2LR8 A;  2XB0 X;  3TW7 A;  1I6H J;  4L5E A;  3GTM J;  1RET A;  1ORK A;  1T33 A;  3A01 A;  3BTI A;  2K9Q A;  1FEX A;  1D5Y A;  5J3L A;  1GV2 A;  3JRH A;  2MGQ A;  2R5Z B;  3JRG A;  1QVT A;  2MW8 A;  1OCT C;  2L9R A;  4UUS A;  3K7A J;  3RZO J;  4HNV A;  1QRY A;  2R0Q C;  2KDZ A;  3ZQH A;  5FJ8 J;  1X58 A;  2DMT A;  2R5Y A;  2M34 A;  2HXI A;  3BTC A;  2ME6 A;  3BR1 A;  2QCO A;  1AKH A;  4C3J J;  2MG4 A;  3Q3S A;  4A93 J;  5EZG A;  2DA4 A;  3TED A;  4G12 A;  3K2A A;  1ZR2 A;  1HOM A;  4FE4 A;  2YUS A;  1B72 B;  3D1N I;  2JA6 J;  4QIW N;  1TWA J;  1JTX A;  1X2M A;  3SFI A;  5FKK A;  4DZJ A;  1MSE C;  2G0E A;  5J1Y A;  1A5J A;  1WCM J;  4A3G J;  1Z77 A;  2X9D A;  5F1J A;  2CU7 A;  1AHD P;  1R9T J;  2DN0 A;  1K61 A;  1B8I A;  3G1L A;  1MNM C;  1ETQ A;  3MN2 A;  1W0U A;  3HM5 A;  2VUM J;  3RKQ A;  1U78 A;  4JX6 A;  5EEA A;  2H8R A;  5E3L A;  4XRS G;  3S2H J;  3HKZ N;  1HF0 A;  1H8A C;  2E2J J;  1QVU A;  3S1M J;  1ETV A;  1GUU A;  3MVP A;  4IHY A;  2K40 A;  2DMQ A;  2Y9Y A;  1DU0 A;  1E3O C;  5FKM A;  3BQZ A;  2PMZ N;  2D5V A;  4MFE A;  2M8G X;  3GTO J;  1FIP A;  1GDT A;  1JT6 A;  3WHC A;  1YRN B;  2LD5 A;  3LNQ A;  2ELK A;  1H88 C;  3H0G J;  1MBK A;  4J19 A;  1IJW C;  2JA5 J;  2R7Z J;  4A3K J;  3GTG J;  3IH3 A;  5GP9 A;  3SDG A;  5M5W J;  1DU6 A;  2CRG A;  2N8G A;  1HDP A;  3QQA A;  1BW5 A;  1LFU P;  1BW6 A;  2HDD A;  1RES A;  2XRL A;  3BTJ A;  2IAI A;  1ZTR A;  2NS8 A;  2ECB A;  2RAE A;  4IEJ A;  1BJZ A;  3GTQ J;  3I4N J;  2ID3 A;  2K9N A;  2DMN A;  5FKO A;  2XPW A;  4A3D J;  3JRI A;  4Y7N J;  5J1R A;  4M3D A;  3JRA A;  4RBO A;  1IGN A;  1QPI A;  4IHX A;  4C3I J;  2LTP A;  5HOD A;  3JRB A;  3BT9 A;  5EG0 B;  3IH2 A;  1OCP A;  2TRT A;  1CQT A;  3F0C A;  3FK6 A;  5E3O A;  2LP0 A;  1MH4 A;  1JTY A;  2M2E A;  3PO3 J;  4UUT A;  5K7Z A;  1FJL A;  4JP0 A;  4MFD A;  2DA6 A;  3HOV J;  3GTL J;  3HOW J;  3PM1 A;  1IV6 A;  4LOC A;  1Y1V J;  3CDL A;  1GVD A;  1TWG J;  3O8G A;  1GT0 C;  2HOS A;  5K7F A;  4M3F A;  1RR7 A;  5IOZ A;  4XK4 A;  4XIC A;  1WH5 A;  5FKL A;  4DW6 A;  3M3Y J;  4M3B A;  1LE8 A;  2X48 A;  1XC5 A;  2EZK A;  2OPT A;  1XG1 A;  1JJ6 C;  4BXX J;  2QF7 A;  3Q0V A;  4AYB N;  2COB A;  2P81 A;  3TW6 A;  3I4M J;  3FKI J;  1I3Q J;  1PUF B;  1RPW A;  2NVT J;  4A3I J;  5J1U A;  2CJJ A;  4C3H J;  1FTT A;  2I10 A;  2GLO A;  3S1Q J;  5FLV A;  1ZR4 A;  3BG9 A;  1IDY A;  1ZQ3 P;  2YS9 A;  2JN6 A;  1K83 J;  3B6A A;  4FCY A;  5F0C A;  1JGG A;  3Q0U A;  5F0F A;  1B72 A;  4A3L J;  2EH3 A;  3B6C A;  1GV5 A;  1ZGW A;  4JX4 A;  5FLM J;  4A3F J;  1X2N A;  2AO9 A;  2DA3 A;  1RKT A;  2CQQ A;  2EQR A;  2JJ7 A;  4BY1 J;  1ETW A;  3G1M A;  2L7M P;  2YU9 J;  1EYF A;  3BG3 A;  5IP7 J;  1UG2 A;  3Q0W A;  2E2I J;  2TCT A;  2FD5 A;  2DA5 A;  2WAQ N;  5F04 A;  1TC3 C;  3S2D J;  3ZOB A;  5E3M A;  3JRC A;  1G2H A;  1MBF A;  3ZQI A;  5EGO B;  5M5Y J;  3IV5 A;  1VF9 A;  3IH4 A;  2FQ4 A;  2O7O A;  1ZKG A;  2XSD C;  3MKL A;  5C4X J;  2XB5 A;  3LSG A;  4V2G A;  1P7I A;  1HDD C;  2NVQ J;  2CUF A;  1JUM A;  3GTK J;  1WI3 A;  3A02 A;  2ME0 A;  3HOX J;  2L0K A;  3LOC A;  3WHB A;  5M5X J;  2LFB A;  2O8K A;  3JRE A;  2VPR A;  1YRN A;  5DTD A;  4DYC A;  3OOU A;  1JT0 A;  2IEK A;  1ADN A;  3OSF A;  3CCY A;  3OIO A;  2HOA A;  4M6V A;  4I6Z A;  4JYK A;  2KT0 A;  1IDZ A;  4GFB A;  3CQZ J;  5GPA A;  3LSJ A;  2DJN A;  3A03 A;  1W0T A;  1OFC X;  3HBL A;  5FKN A;  3LSP A;  3HOY J;  2EZI A;  2DA7 A;  4I76 A;  9ANT A;  5IOY A;  1IUF A;  2HI3 A;  3M4O J;  1MBJ A;  2LVS A;  2LLK A;  3E7L A;  1ETO A;  2DA1 A;  5DS9 A;  1VND A;  1MBG A;  5IYD J;  2XPV A;  4BY7 J;  2JMW A;  3BR2 A;  1JJ8 C;  4D5F A;  1FTZ A;  2CQX A;  3JRF A;  4FTH A;  5EG0 A;  1JUP A;  4CYC B;  4DYR A;  2H1K A;  3LSR A;  1U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...