1E52A

Solution structure of escherichia coli uvrb c-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAAQIRDQLHQLRELFIAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna excision repair
molecule keywords EXCINUCLEASE ABC SUBUNIT
publication title Solution Structure, Hydrodynamics and Thermodynamics of the Uvrb C-Terminal Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 13
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02151 UVR UvrB/uvrC motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.860.10 Few Secondary Structures Irregular DNA Excision Repair, Uvrb; Chain A UVR domain 1e52A00
1QOJA 1YSMA 1E52A 2A26A 3PXGA 2LF0A 4U1CA
chains in the Genus database with same CATH superfamily
3V1AA 1Z0JB 1QOJA 3V1EA 3DKQA 1YSMA 3V1CA 1E52A 1Z0KB 3V1BA 2A26A 3V1FA 1YZMA 3PXGA 2LF0A 3V1DA 4U1CA
chains in the Genus database with same CATH topology
1QOJA 1YSMA 1E52A 2A26A 3PXGA 2LF0A 4U1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOJ A;  1YSM A;  1E52 A;  2A26 A;  3PXG A;  2LF0 A;  4U1C A; 
#chains in the Genus database with same CATH topology
 3V1A A;  1Z0J B;  1QOJ A;  3V1E A;  3DKQ A;  1YSM A;  3V1C A;  1E52 A;  1Z0K B;  3V1B A;  2A26 A;  3V1F A;  1YZM A;  3PXG A;  2LF0 A;  3V1D A;  4U1C A; 
#chains in the Genus database with same CATH homology
 1QOJ A;  1YSM A;  1E52 A;  2A26 A;  3PXG A;  2LF0 A;  4U1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...