1HRRA

The three dimensional structure of the reduced high potential iron-sulfur protein from chromatium vinosum through nmr
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
SAPANAVAADDATAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQADAAGATDEWKGCQLFPGKLINVNGWCASWTLKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer (iron-sulfur)
molecule keywords REDUCED HIGH POTENTIAL IRON SULFUR PROTEIN
publication title The three-dimensional solution structure of the reduced high-potential iron-sulfur protein from Chromatium vinosum through NMR.
pubmed doi rcsb
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1995-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01355 HIPIP High potential iron-sulfur protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.490.10 Few Secondary Structures Irregular High-Potential Iron-Sulfur Protein; Chain A High potential iron-sulphur protein 1hrrA00
2AMSA 5D8VA 3A39A 1PIHA 1JS2A 1HRRA 1EYTA 2HIPA 1PIJA 1HLQA 3HIPA 1NOEA 1B0YA 1ISUA 3A38A 1IUAA 1HPIA 1HRQA 1NEHA 2FLAA 3H31A 1CKUA 1HIPA
chains in the Genus database with same CATH superfamily
2AMSA 5D8VA 3A39A 1PIHA 1JS2A 1HRRA 1EYTA 2HIPA 1PIJA 1HLQA 3HIPA 1NOEA 1B0YA 1ISUA 3A38A 1IUAA 1HPIA 1HRQA 1NEHA 2FLAA 3H31A 1CKUA 1HIPA
chains in the Genus database with same CATH topology
2AMSA 5D8VA 3A39A 1PIHA 1JS2A 1HRRA 1EYTA 2HIPA 1PIJA 1HLQA 3HIPA 1NOEA 1B0YA 1ISUA 3A38A 1IUAA 1HPIA 1HRQA 1NEHA 2FLAA 3H31A 1CKUA 1HIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMS A;  5D8V A;  3A39 A;  1PIH A;  1JS2 A;  1HRR A;  1EYT A;  2HIP A;  1PIJ A;  1HLQ A;  3HIP A;  1NOE A;  1B0Y A;  1ISU A;  3A38 A;  1IUA A;  1HPI A;  1HRQ A;  1NEH A;  2FLA A;  3H31 A;  1CKU A;  1HIP A; 
#chains in the Genus database with same CATH topology
 2AMS A;  5D8V A;  3A39 A;  1PIH A;  1JS2 A;  1HRR A;  1EYT A;  2HIP A;  1PIJ A;  1HLQ A;  3HIP A;  1NOE A;  1B0Y A;  1ISU A;  3A38 A;  1IUA A;  1HPI A;  1HRQ A;  1NEH A;  2FLA A;  3H31 A;  1CKU A;  1HIP A; 
#chains in the Genus database with same CATH homology
 2AMS A;  5D8V A;  3A39 A;  1PIH A;  1JS2 A;  1HRR A;  1EYT A;  2HIP A;  1PIJ A;  1HLQ A;  3HIP A;  1NOE A;  1B0Y A;  1ISU A;  3A38 A;  1IUA A;  1HPI A;  1HRQ A;  1NEH A;  2FLA A;  3H31 A;  1CKU A;  1HIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...