The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
103
|
sequence length |
422
|
structure length |
422
|
Chain Sequence |
REIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGLAIDSKVDFFTFYIPHRHVYGDQWIQFMRDGVNAQPLPSVTCNRYPDHAGYVGTIVPANNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARYGFRCCHLKNIWSAPLPPETKLAEEMGIESNSIDIMGLQAAYAQLHTEQERTYFMQRYRDVISSFGGSTSYDADNRPLLVMHTDFWASGYDVDGTDQSSLGQFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEHHYLAGKSQLTYTDLAGDPALIGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYVNFKYHDLHGFPFLDDAPGTSTGDNLQEAILVRHQDYDACFQSQQLLQWNKQARYNVSVYRHMPTVRDSIMTS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Virus/dna
|
| molecule keywords |
Capsid protein
|
| publication title |
The phiX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells.
pubmed doi rcsb |
| source organism |
Enterobacteria phage phix174
|
| total genus |
103
|
| structure length |
422
|
| sequence length |
422
|
| ec nomenclature | |
| pdb deposition date | 2003-11-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| F | PF02305 | Phage_F | Capsid protein (F protein) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Bacteriophage G4 Capsid Proteins Gpf, Gpg, Gpj, subunit 1 | Microviridae F protein |
#chains in the Genus database with same CATH superfamily 1CD3 F; 1RB8 F; 1AL0 F; 2BPA 1; 1M06 F; 1GFF 1; #chains in the Genus database with same CATH topology 1CD3 F; 1RB8 F; 1AL0 F; 2BPA 1; 1M06 F; 1GFF 1; #chains in the Genus database with same CATH homology 1CD3 F; 1RB8 F; 1AL0 F; 2BPA 1; 1M06 F; 1GFF 1;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
