The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
8
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
AMACWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQNQGNESCTGNGSYPCCNTCQATYTDGDGDWAFENGNWCGIKNSCKQQPQNNNQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Protein binding
|
| molecule keywords |
ENDOGLUCANASE 45A
|
| publication title |
Characterization of a Double Dockerin from the Cellulosome of the Anaerobic Fungus Piromyces Equi.
pubmed doi rcsb |
| source organism |
Piromyces equi
|
| total genus |
8
|
| structure length |
100
|
| sequence length |
100
|
| ec nomenclature | |
| pdb deposition date | 2006-09-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02013 | CBM_10 | Cellulose or protein binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Endoglucanase; Chain: A | Cellulose docking domain, dockering | ||
| Alpha Beta | Alpha-Beta Complex | Endoglucanase; Chain: A | Cellulose docking domain, dockering |
#chains in the Genus database with same CATH superfamily 2J4M A; 1E8Q A; 1E8P A; 2J4N A; #chains in the Genus database with same CATH topology 2J4M A; 1E8Q A; 1E8P A; 2J4N A; #chains in the Genus database with same CATH homology 2J4M A; 1E8Q A; 1E8P A; 2J4N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
