2J4NA

Double dockerin from piromyces equi cel45a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
AMACWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQNQGNESCTGNGSYPCCNTCQATYTDGDGDWAFENGNWCGIKNSCKQQPQNNNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of a Double Dockerin from the Cellulosome of the Anaerobic Fungus Piromyces Equi.
pubmed doi rcsb
molecule keywords ENDOGLUCANASE 45A
molecule tags Protein binding
source organism Piromyces equi
total genus 8
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02013 CBM_10 Cellulose or protein binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1220.10 Alpha Beta Alpha-Beta Complex Endoglucanase; Chain: A Cellulose docking domain, dockering 2j4nA02
3.90.1220.10 Alpha Beta Alpha-Beta Complex Endoglucanase; Chain: A Cellulose docking domain, dockering 2j4nA01
2J4MA 1E8PA 1E8QA 2J4NA
chains in the Genus database with same CATH superfamily
2J4MA 1E8PA 1E8QA 2J4NA
chains in the Genus database with same CATH topology
2J4MA 1E8PA 1E8QA 2J4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4M A;  1E8P A;  1E8Q A;  2J4N A; 
#chains in the Genus database with same CATH topology
 2J4M A;  1E8P A;  1E8Q A;  2J4N A; 
#chains in the Genus database with same CATH homology
 2J4M A;  1E8P A;  1E8Q A;  2J4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...