2JSWA

Nmr structure of the talin c-terminal actin binding site
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
189
structure length
189
Chain Sequence
GIDPFTDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal actin-binding domain of talin.
pubmed doi rcsb
molecule keywords Talin-1
molecule tags Actin-binding protein
source organism Mus musculus
total genus 73
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2007-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1410.10 Mainly Alpha Up-down Bundle I/LWEQ domain I/LWEQ domain 2jswA00
2JSWA 1R0DA 3AY5A
chains in the Genus database with same CATH superfamily
2JSWA 1R0DA 3AY5A
chains in the Genus database with same CATH topology
2JSWA 1R0DA 3AY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSW A;  1R0D A;  3AY5 A; 
#chains in the Genus database with same CATH topology
 2JSW A;  1R0D A;  3AY5 A; 
#chains in the Genus database with same CATH homology
 2JSW A;  1R0D A;  3AY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...