The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
132
|
structure length |
132
|
Chain Sequence |
GASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAATSTWPDMKIVNNIEVTGQAPPGPPA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the Mycobacterium tuberculosis OmpATb protein: A model of an oligomeric channel in the mycobacterial cell wall
pubmed doi rcsb |
| molecule keywords |
Uncharacterized protein Rv0899/MT0922
|
| molecule tags |
Membrane protein
|
| source organism |
Mycobacterium tuberculosis
|
| total genus |
32
|
| structure length |
132
|
| sequence length |
132
|
| ec nomenclature | |
| pdb deposition date | 2009-03-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04972 | BON | BON domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | hypothetical protein tt1634 | hypothetical protein tt1634 |
#chains in the Genus database with same CATH superfamily 2KSM A; 2KGS A; 2L26 A; #chains in the Genus database with same CATH topology 2GL0 A; 2KSM A; 1RLH A; 2EKM A; 2JB7 A; 1VGG A; 2L26 A; 2KGS A; 2D16 A; 1WVQ A; #chains in the Genus database with same CATH homology 2KSM A; 2KGS A; 2L26 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...