1RLHA

Structure of a conserved protein from thermoplasma acidophilum
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
HHHHHHSSGLVPRGSHMVIPAEANIIVGYSHFIKTVEDLNEIIRTHVPGSKYGIGFSEASGDRLIRYDGNDDDLVKACIENIRRISAGHTFVILIRNAYPINILNAVKMCQEVGSIFAATANPLQIIVYKGERGNGVLGVIDGYSPVGVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
total genus 37
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04008 Adenosine_kin Adenosine specific kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.30 Mainly Beta Ribbon Complement Module; domain 1 Ta1353-like 1rlhA01
3.40.1520.10 Alpha Beta 3-Layer(aba) Sandwich hypothetical protein tt1634 Ta1353-like 1rlhA02
1WVQA 2JB7A 2EKMA 1VGGA 1RLHA 2GL0A 2D16A
chains in the Genus database with same CATH superfamily
3IU3I 1PPQA 1OK2A 5HZPB 2EC3A 3INBC 2JRAA 3FGTA 2GL0A 3KZJA 2BZMA 2ZYCA 3IX0A 1SRZA 2CKUA 2RLQA 1QUBA 5HYPA 2RKYA 1TPNA 2XRBA 3ZD1A 1U5MA 4J38B 5DN4A 3ZLDA 3ZLEA 4DJZA 1NWVA 2QY0A 4PO7A 3TVJA 1OK3A 1QGBA 3GXEA 4AYIA 3OEDC 1VVCA 4YIZA 4FXGG 2XRDA 2YRAA 5FO8C 2KGSA 2EHFA 1H03P 3F6KA 5I0QB 2RLPA 2JB7A 3MQLA 3WSXA 1SS2A 3NFPI 4PZ5A 3WSYA 1G4FA 1VGGA 3T5OA 2JGXA 1RLHA 4MUCA 3CALA 1HCCA 2A55A 1HFHA 2RKZA 2EKMA 1OK9A 3EJHA 4F4OC 1ELVA 1FBRA 1MD7A 4LOSA 1C1ZA 1GPZA 5DN5A 2JGWA 2WIIC 3VWOA 1Q3XA 3OP8A 1H2PP 3R62A 4AYMA 2B5ID 4MSLA 4B2RA 3OXUD 3ZD2A 1OJVA 2YBYA 2I2LA 4IGDA 1ZJKA 2KRIA 2X2ZA 1E5GA 4C16A 5HYTB 1GKGA 1WVQA 3GOVA 4WJG2 4KKDA 3ZRZA 4K12A 5JPMG 4LOTA 2L26A 1CKLA 3CI0J 4ZH1D 2ERJA 3L89M 2Y8SA 2O39C 4ONTD 1TPGA 2KMSA 3FGRA 4AYDA 3K3TA 2MCYA 2UWNA 1GKNA 2W80A 2XWJI 3NJAA 1QO6A 4APLA 1GHQB 1H04P 1OJYA 1O9AA 2W81A 2Y8RA 5HYUB 2CG6A 2V8EA 1MD8A 2IZ3A 2G7IA 2LOJA 4JHSA 2XQWC 4A5WB 4BWCA 1VVDA 2IZ4A 1HFIA 2D16A 1Z92B 2RL0A 1UOTP 3SW0X 4CSYA 4N7EA 1G4GA 3ERBA 3KXVA 1TPMA 2XWBF 4YNXA 1E88A 2KSMA 1H2QP 4AYEA 2Y8TA 3RJ3D 2MCZA 3O8EB 3M7PA 1E8BA 1OK1A 2CG7A 4B2SA 1LY2A 1OJWA
chains in the Genus database with same CATH topology
1WVQA 2JB7A 2EKMA 1VGGA 1RLHA 2GL0A 2D16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVQ A;  2JB7 A;  2EKM A;  1VGG A;  1RLH A;  2GL0 A;  2D16 A; 
#chains in the Genus database with same CATH topology
 3IU3 I;  1PPQ A;  1OK2 A;  5HZP B;  2EC3 A;  3INB C;  2JRA A;  3FGT A;  2GL0 A;  3KZJ A;  2BZM A;  2ZYC A;  3IX0 A;  1SRZ A;  2CKU A;  2RLQ A;  1QUB A;  5HYP A;  2RKY A;  1TPN A;  2XRB A;  3ZD1 A;  1U5M A;  4J38 B;  5DN4 A;  3ZLD A;  3ZLE A;  4DJZ A;  1NWV A;  2QY0 A;  4PO7 A;  3TVJ A;  1OK3 A;  1QGB A;  3GXE A;  4AYI A;  3OED C;  1VVC A;  4YIZ A;  4FXG G;  2XRD A;  2YRA A;  5FO8 C;  2KGS A;  2EHF A;  1H03 P;  3F6K A;  5I0Q B;  2RLP A;  2JB7 A;  3MQL A;  3WSX A;  1SS2 A;  3NFP I;  4PZ5 A;  3WSY A;  1G4F A;  1VGG A;  3T5O A;  2JGX A;  1RLH A;  4MUC A;  3CAL A;  1HCC A;  2A55 A;  1HFH A;  2RKZ A;  2EKM A;  1OK9 A;  3EJH A;  4F4O C;  1ELV A;  1FBR A;  1MD7 A;  4LOS A;  1C1Z A;  1GPZ A;  5DN5 A;  2JGW A;  2WII C;  3VWO A;  1Q3X A;  3OP8 A;  1H2P P;  3R62 A;  4AYM A;  2B5I D;  4MSL A;  4B2R A;  3OXU D;  3ZD2 A;  1OJV A;  2YBY A;  2I2L A;  4IGD A;  1ZJK A;  2KRI A;  2X2Z A;  1E5G A;  4C16 A;  5HYT B;  1GKG A;  1WVQ A;  3GOV A;  4WJG 2;  4KKD A;  3ZRZ A;  4K12 A;  5JPM G;  4LOT A;  2L26 A;  1CKL A;  3CI0 J;  4ZH1 D;  2ERJ A;  3L89 M;  2Y8S A;  2O39 C;  4ONT D;  1TPG A;  2KMS A;  3FGR A;  4AYD A;  3K3T A;  2MCY A;  2UWN A;  1GKN A;  2W80 A;  2XWJ I;  3NJA A;  1QO6 A;  4APL A;  1GHQ B;  1H04 P;  1OJY A;  1O9A A;  2W81 A;  2Y8R A;  5HYU B;  2CG6 A;  2V8E A;  1MD8 A;  2IZ3 A;  2G7I A;  2LOJ A;  4JHS A;  2XQW C;  4A5W B;  4BWC A;  1VVD A;  2IZ4 A;  1HFI A;  2D16 A;  1Z92 B;  2RL0 A;  1UOT P;  3SW0 X;  4CSY A;  4N7E A;  1G4G A;  3ERB A;  3KXV A;  1TPM A;  2XWB F;  4YNX A;  1E88 A;  2KSM A;  1H2Q P;  4AYE A;  2Y8T A;  3RJ3 D;  2MCZ A;  3O8E B;  3M7P A;  1E8B A;  1OK1 A;  2CG7 A;  4B2S A;  1LY2 A;  1OJW A; 
#chains in the Genus database with same CATH homology
 1WVQ A;  2JB7 A;  2EKM A;  1VGG A;  1RLH A;  2GL0 A;  2D16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...