1RLHA

Structure of a conserved protein from thermoplasma acidophilum
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
HHHHHHSSGLVPRGSHMVIPAEANIIVGYSHFIKTVEDLNEIIRTHVPGSKYGIGFSEASGDRLIRYDGNDDDLVKACIENIRRISAGHTFVILIRNAYPINILNAVKMCQEVGSIFAATANPLQIIVYKGERGNGVLGVIDGYSPVGVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved protein from T. acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
total genus 37
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04008 Adenosine_kin Adenosine specific kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.30 Mainly Beta Ribbon Complement Module; domain 1 Ta1353-like 1rlhA01
3.40.1520.10 Alpha Beta 3-Layer(aba) Sandwich hypothetical protein tt1634 Ta1353-like 1rlhA02
2GL0A 1VGGA 2EKMA 2JB7A 2D16A 1WVQA 1RLHA
chains in the Genus database with same CATH superfamily
2YRAA 2BZMA 2XQWC 2LOJA 1QUBA 3KXVA 3M7PA 1GHQB 5I0QB 4K12A 1U5MA 1VVCA 3L89M 4C16A 2WIIC 2YBYA 2ZYCA 1GPZA 1VGGA 5DN5A 3MQLA 2IZ3A 2Y8TA 4LOSA 3WSXA 3GXEA 2JGWA 5HZPB 1MD8A 1TPMA 1VVDA 2JB7A 4DJZA 1H04P 3OEDC 4BWCA 2ERJA 3KZJA 1OK1A 3FGTA 1PPQA 1SS2A 3ERBA 2UWNA 4MSLA 5FO8C 2MCYA 1E8BA 1Z92B 1O9AA 4AYIA 2W81A 5HYPA 1MD7A 2KMSA 1QO6A 1OK2A 2EC3A 1GKGA 4IGDA 2CG6A 2RLQA 1HCCA 2Y8SA 3CALA 5HYUB 2JGXA 4PO7A 3SW0X 2L26A 3RJ3D 3TVJA 1FBRA 2Y8RA 1CKLA 3OP8A 2RKZA 1NWVA 4B2SA 2V8EA 4YIZA 2EHFA 3K3TA 4APLA 4J38B 2IZ4A 1TPNA 2O39C 1H2QP 1HFIA 1OJWA 1QGBA 4A5WB 3ZD1A 1G4FA 2B5ID 4AYMA 2RKYA 1LY2A 3EJHA 2I2LA 2X2ZA 3ZLDA 2KSMA 1E88A 4ONTD 2EKMA 3NJAA 2A55A 3ZLEA 3CI0J 3FGRA 3R62A 3ZD2A 3F6KA 2RL0A 4F4OC 1RLHA 5JPMG 2KGSA 1H2PP 3WSYA 3ZRZA 4AYDA 3NFPI 4FXGG 1OK3A 4CSYA 1G4GA 2XWJI 2QY0A 1OJVA 4MUCA 1Q3XA 3T5OA 4KKDA 3IU3I 4AYEA 5DN4A 3VWOA 3IX0A 4WJG2 4YNXA 4JHSA 1HFHA 1OJYA 2CG7A 2JRAA 3GOVA 4ZH1D 4N7EA 2W80A 3OXUD 1UOTP 1OK9A 2RLPA 1E5GA 4B2RA 2D16A 5HYTB 3INBC 2G7IA 1TPGA 1C1ZA 1SRZA 2XRDA 2XWBF 4PZ5A 3O8EB 1GKNA 1WVQA 2MCZA 2XRBA 2KRIA 2GL0A 1ELVA 1H03P 1ZJKA 2CKUA 4LOTA
chains in the Genus database with same CATH topology
2GL0A 1VGGA 2EKMA 2JB7A 2D16A 1WVQA 1RLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GL0 A;  1VGG A;  2EKM A;  2JB7 A;  2D16 A;  1WVQ A;  1RLH A; 
#chains in the Genus database with same CATH topology
 2YRA A;  2BZM A;  2XQW C;  2LOJ A;  1QUB A;  3KXV A;  3M7P A;  1GHQ B;  5I0Q B;  4K12 A;  1U5M A;  1VVC A;  3L89 M;  4C16 A;  2WII C;  2YBY A;  2ZYC A;  1GPZ A;  1VGG A;  5DN5 A;  3MQL A;  2IZ3 A;  2Y8T A;  4LOS A;  3WSX A;  3GXE A;  2JGW A;  5HZP B;  1MD8 A;  1TPM A;  1VVD A;  2JB7 A;  4DJZ A;  1H04 P;  3OED C;  4BWC A;  2ERJ A;  3KZJ A;  1OK1 A;  3FGT A;  1PPQ A;  1SS2 A;  3ERB A;  2UWN A;  4MSL A;  5FO8 C;  2MCY A;  1E8B A;  1Z92 B;  1O9A A;  4AYI A;  2W81 A;  5HYP A;  1MD7 A;  2KMS A;  1QO6 A;  1OK2 A;  2EC3 A;  1GKG A;  4IGD A;  2CG6 A;  2RLQ A;  1HCC A;  2Y8S A;  3CAL A;  5HYU B;  2JGX A;  4PO7 A;  3SW0 X;  2L26 A;  3RJ3 D;  3TVJ A;  1FBR A;  2Y8R A;  1CKL A;  3OP8 A;  2RKZ A;  1NWV A;  4B2S A;  2V8E A;  4YIZ A;  2EHF A;  3K3T A;  4APL A;  4J38 B;  2IZ4 A;  1TPN A;  2O39 C;  1H2Q P;  1HFI A;  1OJW A;  1QGB A;  4A5W B;  3ZD1 A;  1G4F A;  2B5I D;  4AYM A;  2RKY A;  1LY2 A;  3EJH A;  2I2L A;  2X2Z A;  3ZLD A;  2KSM A;  1E88 A;  4ONT D;  2EKM A;  3NJA A;  2A55 A;  3ZLE A;  3CI0 J;  3FGR A;  3R62 A;  3ZD2 A;  3F6K A;  2RL0 A;  4F4O C;  1RLH A;  5JPM G;  2KGS A;  1H2P P;  3WSY A;  3ZRZ A;  4AYD A;  3NFP I;  4FXG G;  1OK3 A;  4CSY A;  1G4G A;  2XWJ I;  2QY0 A;  1OJV A;  4MUC A;  1Q3X A;  3T5O A;  4KKD A;  3IU3 I;  4AYE A;  5DN4 A;  3VWO A;  3IX0 A;  4WJG 2;  4YNX A;  4JHS A;  1HFH A;  1OJY A;  2CG7 A;  2JRA A;  3GOV A;  4ZH1 D;  4N7E A;  2W80 A;  3OXU D;  1UOT P;  1OK9 A;  2RLP A;  1E5G A;  4B2R A;  2D16 A;  5HYT B;  3INB C;  2G7I A;  1TPG A;  1C1Z A;  1SRZ A;  2XRD A;  2XWB F;  4PZ5 A;  3O8E B;  1GKN A;  1WVQ A;  2MCZ A;  2XRB A;  2KRI A;  2GL0 A;  1ELV A;  1H03 P;  1ZJK A;  2CKU A;  4LOT A; 
#chains in the Genus database with same CATH homology
 2GL0 A;  1VGG A;  2EKM A;  2JB7 A;  2D16 A;  1WVQ A;  1RLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...