The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
149
|
structure length |
149
|
Chain Sequence |
MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Comparison of NMR and crystal structures highlights conformational isomerism in protein active sites.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Mus musculus
|
molecule keywords |
AIG2-like domain-containing protein 1
|
total genus |
26
|
structure length |
149
|
sequence length |
149
|
ec nomenclature |
ec
4.3.2.8: Gamma-glutamylamine cyclotransferase. |
pdb deposition date | 2009-06-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06094 | GGACT | Gamma-glutamyl cyclotransferase, AIG2-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Hypothetical upf0131 protein ytfp | Gamma-glutamyl cyclotransferase-like |
#chains in the Genus database with same CATH superfamily 3JUB A; 1V30 A; 2PN7 A; 2Q53 A; 3JUD A; 4IST A; 4ISS A; 5C5Z A; 2KL2 A; 3JUC A; 2I5T A; 1XHS A; 2QIK A; 2JQV A; 2RBH A; 2G0Q A; 3CRY A; 1VKB A; #chains in the Genus database with same CATH topology 1V30 A; 2Q53 A; 2XVO A; 2RBH A; 1VKB A; 3JUD A; 3VKH A; 2G0Q A; 4IST A; 5C5Z A; 3JUC A; 2I5T A; 1XHS A; 4ISS A; 3VKG A; 2JQV A; 3JUB A; 2KL2 A; 3CRY A; 2PN7 A; 2QIK A; #chains in the Genus database with same CATH homology 3JUB A; 1V30 A; 2PN7 A; 2Q53 A; 3JUD A; 4IST A; 4ISS A; 5C5Z A; 2KL2 A; 3JUC A; 2I5T A; 1XHS A; 2QIK A; 2JQV A; 2RBH A; 2G0Q A; 3CRY A; 1VKB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...