The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
131
|
structure length |
131
|
Chain Sequence |
GASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAATSTWPDMKIVNNIEVTGQAPPGPP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel.
pubmed doi rcsb |
molecule tags |
Membrane protein
|
source organism |
Mycobacterium tuberculosis
|
molecule keywords |
MYCOBACTERIUM TUBERCULOSIS RV0899/MT0922/OmpATb
|
total genus |
23
|
structure length |
131
|
sequence length |
131
|
ec nomenclature | |
pdb deposition date | 2010-01-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04972 | BON | BON domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | hypothetical protein tt1634 | hypothetical protein tt1634 |
#chains in the Genus database with same CATH superfamily 2KSM A; 2KGS A; 2L26 A; #chains in the Genus database with same CATH topology 2L26 A; 1WVQ A; 2D16 A; 2GL0 A; 1VGG A; 2EKM A; 2KSM A; 2KGS A; 2JB7 A; 1RLH A; #chains in the Genus database with same CATH homology 2KSM A; 2KGS A; 2L26 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...