The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
158
|
structure length |
158
|
Chain Sequence |
GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Sortase A enzyme that attaches proteins to the cell wall of Bacillus anthracis contains an unusual active site architecture.
pubmed doi rcsb |
| molecule keywords |
LPXTG-site transpeptidase family protein
|
| molecule tags |
Protein binding
|
| source organism |
Bacillus anthracis
|
| total genus |
26
|
| structure length |
158
|
| sequence length |
158
|
| ec nomenclature | |
| pdb deposition date | 2010-03-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04203 | Sortase | Sortase domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Sortase; Chain: A; | Sortase |
#chains in the Genus database with same CATH superfamily 1RZ2 A; 3PSQ A; 5B23 A; 1T2O A; 1QX6 A; 3RE9 A; 1IJA A; 2KID A; 4Y4Q A; 4LFD A; 1NG5 A; 2W1J A; 3FN6 A; 4O8T A; 1QWZ A; 2XWG A; 4O8L B; 4O8L A; 3RBI A; 5GO5 A; 5CUW A; 2KW8 A; 5GYJ A; 1T2P A; 2MLM A; 1T2W A; 3RCC A; 2RUI A; 2W1K A; 1QXA A; 2WTS A; 3FN7 A; 3G66 A; 2OQW A; 3RBK A; 5K9A A; 3FN5 A; 2LN7 A; 3G69 A; 2OQZ A; 3RBJ A; 5JCV A; 4G1J A; 3TBE A; 4D7W A; 4UX7 A; 3TB7 A; 4D70 A; 4G1H A; 3O0P A; #chains in the Genus database with same CATH topology 1RZ2 A; 3PSQ A; 5B23 A; 1T2O A; 1QX6 A; 3RE9 A; 1IJA A; 2KID A; 4Y4Q A; 4LFD A; 1NG5 A; 2W1J A; 3FN6 A; 4O8T A; 1QWZ A; 2XWG A; 4O8L B; 4O8L A; 3RBI A; 5GO5 A; 5CUW A; 2KW8 A; 5GYJ A; 1T2P A; 2MLM A; 1T2W A; 3RCC A; 2RUI A; 2W1K A; 1QXA A; 2WTS A; 3FN7 A; 3G66 A; 2OQW A; 3RBK A; 5K9A A; 3FN5 A; 2LN7 A; 3G69 A; 2OQZ A; 3RBJ A; 5JCV A; 4G1J A; 3TBE A; 4D7W A; 4UX7 A; 3TB7 A; 4D70 A; 4G1H A; 3O0P A; #chains in the Genus database with same CATH homology 1RZ2 A; 3PSQ A; 5B23 A; 1T2O A; 1QX6 A; 3RE9 A; 1IJA A; 2KID A; 4Y4Q A; 4LFD A; 1NG5 A; 2W1J A; 3FN6 A; 4O8T A; 1QWZ A; 2XWG A; 4O8L B; 4O8L A; 3RBI A; 5GO5 A; 5CUW A; 2KW8 A; 5GYJ A; 1T2P A; 2MLM A; 1T2W A; 3RCC A; 2RUI A; 2W1K A; 1QXA A; 2WTS A; 3FN7 A; 3G66 A; 2OQW A; 3RBK A; 5K9A A; 3FN5 A; 2LN7 A; 3G69 A; 2OQZ A; 3RBJ A; 5JCV A; 4G1J A; 3TBE A; 4D7W A; 4UX7 A; 3TB7 A; 4D70 A; 4G1H A; 3O0P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...