The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINQFMYFCDNKFHTEALTALLSDLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Selectivity of stop codon recognition in translation termination is modulated by multiple conformations of GTS loop in eRF1
pubmed doi rcsb |
| molecule keywords |
Eukaryotic peptide chain release factor subunit 1
|
| molecule tags |
Translation
|
| source organism |
Homo sapiens
|
| total genus |
31
|
| structure length |
144
|
| sequence length |
144
|
| ec nomenclature | |
| pdb deposition date | 2011-08-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03463 | eRF1_1 | eRF1 domain 1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation, Eukaryotic Peptide Chain Release Factor Subunit 1; Chain A | Translation, Eukaryotic Peptide Chain Release Factor Subunit 1; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 3E1Y A; 3VMF B; 2MQ6 A; 2LGT A; 2LLX A; 3E20 B; 3AGK A; 1DT9 A; 2MQ9 A; #chains in the Genus database with same CATH topology 3E1Y A; 3VMF B; 2MQ6 A; 2LGT A; 2LLX A; 3E20 B; 3AGK A; 1DT9 A; 2MQ9 A; #chains in the Genus database with same CATH homology 3E1Y A; 3VMF B; 2MQ6 A; 2LGT A; 2LLX A; 3E20 B; 3AGK A; 1DT9 A; 2MQ9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...