The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
112
|
structure length |
112
|
Chain Sequence |
MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKKLLIIISRPAR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A
rcsb |
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
molecule keywords |
Microtubule-associated serine/threonine-protein kinase 1
|
total genus |
36
|
structure length |
112
|
sequence length |
112
|
ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
pdb deposition date | 2013-06-20 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | hypothetical protein mp506/mpn330, domain 1 | MAST3 pre-PK domain-like |
#chains in the Genus database with same CATH superfamily 1V9V A; 2M9X A; #chains in the Genus database with same CATH topology 4GN0 A; 1TD6 A; 1P68 A; 1V9V A; 2JUA A; 3VJF A; 4L3U A; 4CQ4 A; 2M9X A; #chains in the Genus database with same CATH homology 1V9V A; 2M9X A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...