The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
1
|
sequence length |
69
|
structure length |
69
|
Chain Sequence |
MPKIIEAVYENGVFKPLQKVDLKEGERVKIKLELKVEPIDLGEPVSVEEIKKIRDGTWMSSLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR Structure of Protein Y2212_ARCFU from Archaeoglobus Fulgidus; Northeast Structural Genomics Consortium Target GR83
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Archaeoglobus fulgidus
|
| molecule keywords |
UPF0165 protein AF_2212
|
| total genus |
1
|
| structure length |
69
|
| sequence length |
69
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2006-11-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01954 | DUF104 | Protein of unknown function DUF104 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | AF2212/PG0164-like | AF2212/PG0164-like |
#chains in the Genus database with same CATH superfamily 2NWT A; #chains in the Genus database with same CATH topology 2NWT A; #chains in the Genus database with same CATH homology 2NWT A; 2D9R A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
