2D9RA

Structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83]
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08922 DUF1905 Domain of unknown function (DUF1905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.100 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 AF2212/PG0164-like 2d9rA00
2D9RA
chains in the Genus database with same CATH superfamily
3AGPA 3CP8A 3CCRB 4Z4WA 1VQ5B 2VNIA 1H85A 1E79A 2D3NA 1WPCA 4TMVA 5IYPA 1TLLA 1JA0A 1JA1A 1F20A 1NJID 3AVVA 2BV3A 2W6JA 4HIZA 5IYNA 4P3YA 1OB2A 1OHHA 2F43A 2C78A 5FA6A 3CCLB 1EFCA 4XN0A 1H8HA 2X8KA 2CW5A 1W0KA 1ZM4A 2B5OA 2V4DA 3WNBA 2VBVA 2VJIA 4RPBA 3ZBTA 3BC9A 1DDGA 1KC8D 2QGGA 2XGJA 3LQEA 1UD4A 2R6HA 1YITB 3CRZA 4RDJA 2X0KA 2Q6LA 1PJ6A 4RDKA 3T51B 4UAJA 4WZEA 1VLYA 2GPJA 2C5BA 2QEXB 3OJWA 4X06A 4FXUA 3A35A 1VHEA 4RLZA 5DS0A 2CK3A 1RQPA 2VBTA 4P25A 3AGQA 3VO2A 1VQ8B 3VNUA 1EP2B 4J0QA 4DQKA 2QA4B 2BN4A 4X7CA 1U2RA 1YJWB 1OB0A 2FX3A 3B8HA 2EFGA 3ASTA 2EIXA 1WSVA 2ZBVA 4XQFA 3CCEB 5IK2A 4XL9A 2ZTGA 1G7SA 1EWYA 2VZLA 4DK0A 2D74A 2CC2A 1EFTA 3U6BA 3WBKA 1BJKA 2WJVA 3JU4A 2QTLA 4Z4VA 1NRKA 4B3GA 4WQMA 1EP3B 4NCNA 3P26A 4XN3A 2KVOA 2C2WA 3OOCA 4OOSA 5EMNA 5H59A 1EP1B 1M90D 4B48A 3QSYA 1E1QA 5TV2A 4P22A 2V7WA 1QH0A 2HLDA 2WZPP 2VBSA 1G7RA 4WZLA 3FPPA 2VNHA 4QVAA 4Y9RA 2YWFA 1BLIA 2ZZQA 3ZIAA 2DY1A 1QVGB 1T5EA 5FL7A 1BPLA 1NB0A 4FWTA 1W87A 2X85A 3T53B 2X6WA 5A88A 2YWHA 3Q3AA 1W2BB 1T6YA 2F4NA 4WZKA 5DSZA 4NBSA 3SKBA 1RQRA 1SM4A 1UD5A 1I7PA 2BGJA 2PLFA 2X6XA 3BCDA 3ASPA 1SKYB 2ZZGA 1Q7YD 5HKKA 3OZUA 1EFRA 2V7VA 3E1YE 2ZXIA 1GJRA 4B4DA 3G6EB 3HAGA 1QUFA 3D26A 1G7CA 4X07A 3W5UA 4YAUA 2ZL5A 1WU8A 5F4MA 2XNJA 3SLDA 1N8RD 1QUEA 3OJXA 2BVNA 4Z4TA 1Q81D 2CF4A 1V0EA 1WOSA 3MMPA 1MABA 3OEHA 3QE2A 4XR6A 5KSWB 4FN5A 5FNZA 1KTVA 5HZAA 3CTAA 3ZZUA 4B47A 2W6IA 5GV7A 3CPWB 4DNTB 2Q6KA 3FJOA 1VQKB 1UMKA 5DN6A 4P26A 5HZBA 4ACBA 1W34A 3H9NA 3I56B 1JJ2B 1B23P 2Q6OA 4TMTA 4LC0A 2V7TA 1PJ7A 2ZBUA 1W35A 2Q6IA 3ASRA 4X7EA 3W5HA 1AIPA 2GK7A 5FO1A 1YI2B 3BCFA 1S72B 3LQ6A 4YXWA 2JN9A 3W2EA 4M1KA 4QFMA 4P2NA 4RD2A 1WDTA 3PUMA 1S4MA 4YEJA 3OAAA 5KW9A 4P1VA 4TT3A 5LMZA 1CQXA 2V7QA 3OW7A 2QE7A 1KZLA 2GQFA 1QFYA 4XKWA 1J9ZA 2XZLA 4YAOA 1D8TA 3PUNA 3CCSB 1Q86D 2WYRA 4MYTA 3A3BA 3MCAA 3ONUA 4PC6A 4YHBA 4Y7CA 1QVFB 1ZM3A 3VMFA 1GAQA 1SKQA 4XKVA 1N08A 4H9GA 3BY2A 4B3FX 3CESA 3OEEA 4TMXA 3W2IA 1KK0A 1EFUA 3JQPA 4X7DA 1N07A 4CQJA 1T6ZA 1DG1G 1GR1A 4PC7A 3CC4B 1H8EA 3I1FA 1OGIA 3LVBA 3WYAA 4X05A 2DERA 2BMWA 5IYWA 1N0UA 4KKUA 2C4TA 1WTHD 2BM1A 4R71A 2RC5A 3VNVA 3ISXA 5HXBA 3ZZ0A 4ACAA 3GQBA 1DARA 2DETA 3WXMA 1FNMA 2DOGA 1QGZA 3BQJA 2AHOA 1GO2A 2DCUA 2RC6A 4ZGNB 3W2GA 2CRVA 3A3GA 4HE5A 5KNLA 2E1RA 4G7WA 3AVUA 2V7UA 4LBWA 2BF4A 3FKSA 3Q38A 4WZTA 3CW2A 2XEXA 2B7CA 1VQ6B 1YLOA 3WNCA 1T6XA 2QDXA 2PIAA 4E0FA 4DK1A 4BPRA 3CCMB 3A8JA 2WZNA 4TMZA 4WWVA 1R5OA 4QV2A 1XQBA 4G7XA 2XZPA 1TVCA 3SEJA 1OB5A 1VQLB 3G4SB 1TTTA 4KKTA 3GVKA 3A8IA 3CP2A 3RY8A 1VQ4B 4YELA 1CNEA 1XFOA 1V0FA 3JQQA 4P12A 3NE5B 4B44A 2NV4A 2D3LA 5J3OA 2X3UA 1DDIA 4XONA 3OW2B 4ROXA 2LZJA 4ZCLA 1W9XA 4XLFA 5B6IA 1YJNB 2GJPA 3CXCB 1F60A 2VYQA 2GREA 3BH4A 4OPSA 4DNRB 1V5VA 3GSIA 1M1KD 1CNFA 1VHOA 3B78A 1KQSB 1R5BA 1W0JA 1R5NA 1GVHA 2ZZEA 1KK2A 4RPDA 4U9UA 3H94A 2NPFA 1AMOA 4OPVA 1HVXA 1XB2A 4RM0A 4P3IA 5A8AA 1TUIA 4KKSA 3ZC3A 3CC7B 4RD3A 2ZL7A 2QN6A 3ZUGA 1FNCA 1I8DA 2OBTA 1K73D 3QFTA 1VF7A 4G6IA 4PC1A 4M4SA 4XLEA 5TR9A 2I1LA 5AN9A 4N3GA 1ZM2A 3CCUB 1QX4A 4M2LA 1QFZA 5CDFA 4ASUA 3ONYA 3PENA 3Q6RA 1YHQB 4UZUA 1YIJB 2F1LA 1FNBA 1VLOA 2ZTNA 3ES9A 4Z4UA 4RCZA 1BX0A 3B82A 2B7BA 3PA2A 5GV8A 5BSXA 5IYQA 2BGIA 1KK1A 1QGAA 2ZITA 3I55B 2V7XA 1B2RA 1ZUNB 4PABA 1IB0A 5L46A 2QTZA 1UD6A 4XM3A 3SJZA 1VQPB 2F1MA 2ZXHA 5J35A 3OFNA 4QVJA 3CB4A 4N3NA 3KL9A 4XORA 4PC3A 4XNFA 2DIEA 1JB9A 2X53S 4K1XA 1KMHA 3VR6A 3AVXA 2WPDA 4UZEA 2E1BA 4XLHA 4X0CA 3AVWA 3OZVA 3WQZA 2VNKA 2OTJB 4JMQA 3U2QA 3JQRA 1NDHA 1K9MD 5TRDA 1EXMA 2FVGA 2HCJB 1VQ7B 2C4UA 4YAWA 4F7DA 3CCJB 5FO0A 2BM0A 3AVYA 1JNYA 4Z4RA 5F4OA 1P4MA 1Q9SA 1BQEA 1HA3A 3OKXA 1IJEA 4XLCA 2YWEA 4LBVA 2Z6BD 3CPXA 3OPOA 5JBQA 4PC2A 2GJKA 1UD2A 4G1VA 1OGJA 2OK7A 2WR8A 1GAWA 1FDRA 3MHPA 4B43A 1E63A 5BSYA 4P9SA 1QFJA 1YJ9B 1KJZA 2WJYA 4X8IA 2P3MA 4MYUA 3GVLA 3R6KA 4XD7A 1E1RA 2JIZA 3OE7A 4Z4YA 5IYRA 2CBXA 2V31A 1Y0YA 1E3XA 1QG0A 2DEUA 3QFRA 1N06A 4PAAA 3AVTA 1E43A 4FK8A 3W5VA 1WSRA 3WNDA 3ZZTA 4UZFA 3WBJA 3BY1A 1HZEA 1N0VC 3QFSA 5FIUA 1D2EA 2OTLB 1E64A 2J7KA 1UD3A 4C43A 3Q39A 1QGYA 3W2HA 4Z1MA 4Q7JB 3FPKA 3U6KA 1KRHA 1E62A 2GJRA 1VQOB 4B3XA 2C5HA 4GQNA 4C0SA 2CNDA 2D9RA 4TMWA 1ZM9A 3PVDA 5F4JA 3GIRA 5E6TA 4RJLA 1FNDA 4II3A 3Q6QA 1H42A 3LNNA 4TSFA 3CMEB 4Z4ZA 4G5GA 4Z4SA 4QHYA 2VBUA 1VJSA 2VJJA 4HE6A 1WOOA 2BSAA 2HDNB 4RD1A 5H5JA 4Y9UA 1COWA 2PMDA 1G7TA 1WORA 1WP6A 1PKVA 2XNCA 3CCQB 4PGOA 3CCVB 4AVZA 4M53A 5TY0A 3QFCA 4XOTA 2JJ2A 2ZZFA 3KEWA 3SJPA 2VNJA 2OYNA 1BMFA 1N05A 2C77A 3ASSA 2M5SA 2GK6A 1K28D 1FRNA 1XE1A 1Y0RA 3GVJA 5A89A 3A8KA 1FRQA 1K8AD 4RD4A 4L8JA 2XOKA 4EH1A 1VQNB 4OPOA 3R6JA 3SLNA 1NB9A 2HMAA 1Q82D 3A1PA 2DYIA 1A8PA 4YALA 4IW3B 1FX0A 3OP1A 3W2FA 3G71B 1VQ9B 1KK3A 3BNWA 4ZGQB 4LBZA 4AF7A 3ZBUA 4YAFA 4LBYA 3WY9A 1YX2A 2YWGA 4NNJA 3P27A 3PA1A 4RCYA 1WOPA 3LO8A 4XMYA 1S0UA 3CMMA 3VO1A 3J81k 1IHMA 1IJFA 2X6YA 4M0LA 4ZV4A 3ASQA 4XOPA 2JDIA 1PJ5A 2OBSA 4P6YA 4TN1A 4ZCMA 4RD0A 1VQMB 4RD6A 1MRZA 2QMUA 2R9VA 4TKOB 3G05A 4AC9A 4OOXA 2ZL6A 4II2A 4X7FA 3V7AA 4RDLA 2XZOA 1ELOA 4G1BA 2JJ1A 1NBMA 3V76A 4QUZA 4XLAA 5THXA 4AF6A 3CC2B 3CD6B 2XNDA 1I18A 3E20A 1KD1D 2BPOA 2OK8A 3T56B 4P6VF 2WSSA 2OBRA 4OP7A 3CMAB 1E3ZA 4OOVA 1UD8A 4ZCIA 3DDYA 1BX1A 2PE3A 4DQLA 1D1NA 3OZWA 3ZPNA
chains in the Genus database with same CATH topology
2NWTA 2D9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9R A; 
#chains in the Genus database with same CATH topology
 3AGP A;  3CP8 A;  3CCR B;  4Z4W A;  1VQ5 B;  2VNI A;  1H85 A;  1E79 A;  2D3N A;  1WPC A;  4TMV A;  5IYP A;  1TLL A;  1JA0 A;  1JA1 A;  1F20 A;  1NJI D;  3AVV A;  2BV3 A;  2W6J A;  4HIZ A;  5IYN A;  4P3Y A;  1OB2 A;  1OHH A;  2F43 A;  2C78 A;  5FA6 A;  3CCL B;  1EFC A;  4XN0 A;  1H8H A;  2X8K A;  2CW5 A;  1W0K A;  1ZM4 A;  2B5O A;  2V4D A;  3WNB A;  2VBV A;  2VJI A;  4RPB A;  3ZBT A;  3BC9 A;  1DDG A;  1KC8 D;  2QGG A;  2XGJ A;  3LQE A;  1UD4 A;  2R6H A;  1YIT B;  3CRZ A;  4RDJ A;  2X0K A;  2Q6L A;  1PJ6 A;  4RDK A;  3T51 B;  4UAJ A;  4WZE A;  1VLY A;  2GPJ A;  2C5B A;  2QEX B;  3OJW A;  4X06 A;  4FXU A;  3A35 A;  1VHE A;  4RLZ A;  5DS0 A;  2CK3 A;  1RQP A;  2VBT A;  4P25 A;  3AGQ A;  3VO2 A;  1VQ8 B;  3VNU A;  1EP2 B;  4J0Q A;  4DQK A;  2QA4 B;  2BN4 A;  4X7C A;  1U2R A;  1YJW B;  1OB0 A;  2FX3 A;  3B8H A;  2EFG A;  3AST A;  2EIX A;  1WSV A;  2ZBV A;  4XQF A;  3CCE B;  5IK2 A;  4XL9 A;  2ZTG A;  1G7S A;  1EWY A;  2VZL A;  4DK0 A;  2D74 A;  2CC2 A;  1EFT A;  3U6B A;  3WBK A;  1BJK A;  2WJV A;  3JU4 A;  2QTL A;  4Z4V A;  1NRK A;  4B3G A;  4WQM A;  1EP3 B;  4NCN A;  3P26 A;  4XN3 A;  2KVO A;  2C2W A;  3OOC A;  4OOS A;  5EMN A;  5H59 A;  1EP1 B;  1M90 D;  4B48 A;  3QSY A;  1E1Q A;  5TV2 A;  4P22 A;  2V7W A;  1QH0 A;  2HLD A;  2WZP P;  2VBS A;  1G7R A;  4WZL A;  3FPP A;  2VNH A;  4QVA A;  4Y9R A;  2YWF A;  1BLI A;  2ZZQ A;  3ZIA A;  2DY1 A;  1QVG B;  1T5E A;  5FL7 A;  1BPL A;  1NB0 A;  4FWT A;  1W87 A;  2X85 A;  3T53 B;  2X6W A;  5A88 A;  2YWH A;  3Q3A A;  1W2B B;  1T6Y A;  2F4N A;  4WZK A;  5DSZ A;  4NBS A;  3SKB A;  1RQR A;  1SM4 A;  1UD5 A;  1I7P A;  2BGJ A;  2PLF A;  2X6X A;  3BCD A;  3ASP A;  1SKY B;  2ZZG A;  1Q7Y D;  5HKK A;  3OZU A;  1EFR A;  2V7V A;  3E1Y E;  2ZXI A;  1GJR A;  4B4D A;  3G6E B;  3HAG A;  1QUF A;  3D26 A;  1G7C A;  4X07 A;  3W5U A;  4YAU A;  2ZL5 A;  1WU8 A;  5F4M A;  2XNJ A;  3SLD A;  1N8R D;  1QUE A;  3OJX A;  2BVN A;  4Z4T A;  1Q81 D;  2CF4 A;  1V0E A;  1WOS A;  3MMP A;  1MAB A;  3OEH A;  3QE2 A;  4XR6 A;  5KSW B;  4FN5 A;  5FNZ A;  1KTV A;  5HZA A;  3CTA A;  3ZZU A;  4B47 A;  2W6I A;  5GV7 A;  3CPW B;  4DNT B;  2Q6K A;  3FJO A;  1VQK B;  1UMK A;  5DN6 A;  4P26 A;  5HZB A;  4ACB A;  1W34 A;  3H9N A;  3I56 B;  1JJ2 B;  1B23 P;  2Q6O A;  4TMT A;  4LC0 A;  2V7T A;  1PJ7 A;  2ZBU A;  1W35 A;  2Q6I A;  3ASR A;  4X7E A;  3W5H A;  1AIP A;  2GK7 A;  5FO1 A;  1YI2 B;  3BCF A;  1S72 B;  3LQ6 A;  4YXW A;  2JN9 A;  3W2E A;  4M1K A;  4QFM A;  4P2N A;  4RD2 A;  1WDT A;  3PUM A;  1S4M A;  4YEJ A;  3OAA A;  5KW9 A;  4P1V A;  4TT3 A;  5LMZ A;  1CQX A;  2V7Q A;  3OW7 A;  2QE7 A;  1KZL A;  2GQF A;  1QFY A;  4XKW A;  1J9Z A;  2XZL A;  4YAO A;  1D8T A;  3PUN A;  3CCS B;  1Q86 D;  2WYR A;  4MYT A;  3A3B A;  3MCA A;  3ONU A;  4PC6 A;  4YHB A;  4Y7C A;  1QVF B;  1ZM3 A;  3VMF A;  1GAQ A;  1SKQ A;  4XKV A;  1N08 A;  4H9G A;  3BY2 A;  4B3F X;  3CES A;  3OEE A;  4TMX A;  3W2I A;  1KK0 A;  1EFU A;  3JQP A;  4X7D A;  1N07 A;  4CQJ A;  1T6Z A;  1DG1 G;  1GR1 A;  4PC7 A;  3CC4 B;  1H8E A;  3I1F A;  1OGI A;  3LVB A;  3WYA A;  4X05 A;  2DER A;  2BMW A;  5IYW A;  1N0U A;  4KKU A;  2C4T A;  1WTH D;  2BM1 A;  4R71 A;  2RC5 A;  3VNV A;  3ISX A;  5HXB A;  3ZZ0 A;  4ACA A;  3GQB A;  1DAR A;  2DET A;  3WXM A;  1FNM A;  2DOG A;  1QGZ A;  3BQJ A;  2AHO A;  1GO2 A;  2DCU A;  2RC6 A;  4ZGN B;  3W2G A;  2CRV A;  3A3G A;  4HE5 A;  5KNL A;  2E1R A;  4G7W A;  3AVU A;  2V7U A;  4LBW A;  2BF4 A;  3FKS A;  3Q38 A;  4WZT A;  3CW2 A;  2XEX A;  2B7C A;  1VQ6 B;  1YLO A;  3WNC A;  1T6X A;  2QDX A;  2PIA A;  4E0F A;  4DK1 A;  4BPR A;  3CCM B;  3A8J A;  2WZN A;  4TMZ A;  4WWV A;  1R5O A;  4QV2 A;  1XQB A;  4G7X A;  2XZP A;  1TVC A;  3SEJ A;  1OB5 A;  1VQL B;  3G4S B;  1TTT A;  4KKT A;  3GVK A;  3A8I A;  3CP2 A;  3RY8 A;  1VQ4 B;  4YEL A;  1CNE A;  1XFO A;  1V0F A;  3JQQ A;  4P12 A;  3NE5 B;  4B44 A;  2NV4 A;  2D3L A;  5J3O A;  2X3U A;  1DDI A;  4XON A;  3OW2 B;  4ROX A;  2LZJ A;  4ZCL A;  1W9X A;  4XLF A;  5B6I A;  1YJN B;  2GJP A;  3CXC B;  1F60 A;  2VYQ A;  2GRE A;  3BH4 A;  4OPS A;  4DNR B;  1V5V A;  3GSI A;  1M1K D;  1CNF A;  1VHO A;  3B78 A;  1KQS B;  1R5B A;  1W0J A;  1R5N A;  1GVH A;  2ZZE A;  1KK2 A;  4RPD A;  4U9U A;  3H94 A;  2NPF A;  1AMO A;  4OPV A;  1HVX A;  1XB2 A;  4RM0 A;  4P3I A;  5A8A A;  1TUI A;  4KKS A;  3ZC3 A;  3CC7 B;  4RD3 A;  2ZL7 A;  2QN6 A;  3ZUG A;  1FNC A;  1I8D A;  2OBT A;  1K73 D;  3QFT A;  1VF7 A;  4G6I A;  4PC1 A;  4M4S A;  4XLE A;  5TR9 A;  2I1L A;  5AN9 A;  4N3G A;  1ZM2 A;  3CCU B;  1QX4 A;  4M2L A;  1QFZ A;  5CDF A;  4ASU A;  3ONY A;  3PEN A;  3Q6R A;  1YHQ B;  4UZU A;  1YIJ B;  2F1L A;  1FNB A;  1VLO A;  2ZTN A;  3ES9 A;  4Z4U A;  4RCZ A;  1BX0 A;  3B82 A;  2B7B A;  3PA2 A;  5GV8 A;  5BSX A;  5IYQ A;  2BGI A;  1KK1 A;  1QGA A;  2ZIT A;  3I55 B;  2V7X A;  1B2R A;  1ZUN B;  4PAB A;  1IB0 A;  5L46 A;  2QTZ A;  1UD6 A;  4XM3 A;  3SJZ A;  1VQP B;  2F1M A;  2ZXH A;  5J35 A;  3OFN A;  4QVJ A;  3CB4 A;  4N3N A;  3KL9 A;  4XOR A;  4PC3 A;  4XNF A;  2DIE A;  1JB9 A;  2X53 S;  4K1X A;  1KMH A;  3VR6 A;  3AVX A;  2WPD A;  4UZE A;  2E1B A;  4XLH A;  4X0C A;  3AVW A;  3OZV A;  3WQZ A;  2VNK A;  2OTJ B;  4JMQ A;  3U2Q A;  3JQR A;  1NDH A;  1K9M D;  5TRD A;  1EXM A;  2FVG A;  2HCJ B;  1VQ7 B;  2C4U A;  4YAW A;  4F7D A;  3CCJ B;  5FO0 A;  2BM0 A;  3AVY A;  1JNY A;  4Z4R A;  5F4O A;  1P4M A;  1Q9S A;  1BQE A;  1HA3 A;  3OKX A;  1IJE A;  4XLC A;  2YWE A;  4LBV A;  2Z6B D;  3CPX A;  3OPO A;  5JBQ A;  4PC2 A;  2GJK A;  1UD2 A;  4G1V A;  1OGJ A;  2OK7 A;  2WR8 A;  1GAW A;  1FDR A;  3MHP A;  4B43 A;  1E63 A;  5BSY A;  4P9S A;  1QFJ A;  1YJ9 B;  1KJZ A;  2WJY A;  4X8I A;  2P3M A;  4MYU A;  3GVL A;  3R6K A;  4XD7 A;  1E1R A;  2JIZ A;  3OE7 A;  4Z4Y A;  5IYR A;  2CBX A;  2V31 A;  1Y0Y A;  1E3X A;  1QG0 A;  2DEU A;  3QFR A;  1N06 A;  4PAA A;  3AVT A;  1E43 A;  4FK8 A;  3W5V A;  1WSR A;  3WND A;  3ZZT A;  4UZF A;  3WBJ A;  3BY1 A;  1HZE A;  1N0V C;  3QFS A;  5FIU A;  1D2E A;  2OTL B;  1E64 A;  2J7K A;  1UD3 A;  4C43 A;  3Q39 A;  1QGY A;  3W2H A;  4Z1M A;  4Q7J B;  3FPK A;  3U6K A;  1KRH A;  1E62 A;  2GJR A;  1VQO B;  4B3X A;  2C5H A;  4GQN A;  4C0S A;  2CND A;  2D9R A;  4TMW A;  1ZM9 A;  3PVD A;  5F4J A;  3GIR A;  5E6T A;  4RJL A;  1FND A;  4II3 A;  3Q6Q A;  1H42 A;  3LNN A;  4TSF A;  3CME B;  4Z4Z A;  4G5G A;  4Z4S A;  4QHY A;  2VBU A;  1VJS A;  2VJJ A;  4HE6 A;  1WOO A;  2BSA A;  2HDN B;  4RD1 A;  5H5J A;  4Y9U A;  1COW A;  2PMD A;  1G7T A;  1WOR A;  1WP6 A;  1PKV A;  2XNC A;  3CCQ B;  4PGO A;  3CCV B;  4AVZ A;  4M53 A;  5TY0 A;  3QFC A;  4XOT A;  2JJ2 A;  2ZZF A;  3KEW A;  3SJP A;  2VNJ A;  2OYN A;  1BMF A;  1N05 A;  2C77 A;  3ASS A;  2M5S A;  2GK6 A;  1K28 D;  1FRN A;  1XE1 A;  1Y0R A;  3GVJ A;  5A89 A;  3A8K A;  1FRQ A;  1K8A D;  4RD4 A;  4L8J A;  2XOK A;  4EH1 A;  1VQN B;  4OPO A;  3R6J A;  3SLN A;  1NB9 A;  2HMA A;  1Q82 D;  3A1P A;  2DYI A;  1A8P A;  4YAL A;  4IW3 B;  1FX0 A;  3OP1 A;  3W2F A;  3G71 B;  1VQ9 B;  1KK3 A;  3BNW A;  4ZGQ B;  4LBZ A;  4AF7 A;  3ZBU A;  4YAF A;  4LBY A;  3WY9 A;  1YX2 A;  2YWG A;  4NNJ A;  3P27 A;  3PA1 A;  4RCY A;  1WOP A;  3LO8 A;  4XMY A;  1S0U A;  3CMM A;  3VO1 A;  3J81 k;  1IHM A;  1IJF A;  2X6Y A;  4M0L A;  4ZV4 A;  3ASQ A;  4XOP A;  2JDI A;  1PJ5 A;  2OBS A;  4P6Y A;  4TN1 A;  4ZCM A;  4RD0 A;  1VQM B;  4RD6 A;  1MRZ A;  2QMU A;  2R9V A;  4TKO B;  3G05 A;  4AC9 A;  4OOX A;  2ZL6 A;  4II2 A;  4X7F A;  3V7A A;  4RDL A;  2XZO A;  1ELO A;  4G1B A;  2JJ1 A;  1NBM A;  3V76 A;  4QUZ A;  4XLA A;  5THX A;  4AF6 A;  3CC2 B;  3CD6 B;  2XND A;  1I18 A;  3E20 A;  1KD1 D;  2BPO A;  2OK8 A;  3T56 B;  4P6V F;  2WSS A;  2OBR A;  4OP7 A;  3CMA B;  1E3Z A;  4OOV A;  1UD8 A;  4ZCI A;  3DDY A;  1BX1 A;  2PE3 A;  4DQL A;  1D1N A;  3OZW A;  3ZPN A; 
#chains in the Genus database with same CATH homology
 2NWT A;  2D9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...