2D9RA

Structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83]
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]
rcsb
source organism Porphyromonas gingivalis
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08922 DUF1905 Domain of unknown function (DUF1905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.100 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 AF2212/PG0164-like 2d9rA00
2D9RA
chains in the Genus database with same CATH superfamily
1WORA 5J35A 5F4MA 3OZWA 1VHEA 2LZJA 2VBSA 2YWGA 3BCDA 5BSYA 2ZTNA 3MHPA 1Q86D 1N05A 4DQLA 3CCSB 1QFYA 2C5BA 4TMTA 1W35A 2BV3A 3OZUA 2C78A 2VNIA 1F20A 3LVBA 3CC7B 5H5JA 4TT3A 3E1YE 2V7VA 2B7CA 3PA1A 3W2EA 2V4DA 2DOGA 1KK3A 5HZBA 1TVCA 2GK7A 3CCMB 4P2NA 1I7PA 5J3OA 2VBUA 3ASRA 3CCLB 4QV2A 3CCEB 4QVJA 4RPDA 1I8DA 5HKKA 2D9RA 5TRDA 4XLCA 2OK7A 4LBVA 1EWYA 2JJ2A 1KD1D 4RDJA 4FK8A 4XORA 4Z4RA 3CC4B 1T6ZA 1VQNB 1T6XA 3P27A 2ZBUA 1Y0RA 4FWTA 1JA0A 1BX1A 5TR9A 1PJ7A 2XEXA 3A3GA 1JA1A 1EFTA 2GJPA 4WZKA 1D1NA 4DK1A 1VJSA 5EMNA 3MCAA 3G71B 2VYQA 3G6EB 2ZTGA 3VNVA 1K28D 3U6KA 2OK8A 1VQKB 2Q6KA 4YAOA 1QUFA 4OOVA 2C4TA 3LNNA 1BJKA 2CW5A 3CP2A 4RD1A 4PC6A 2XZOA 1UD6A 1EXMA 2KVOA 4RD6A 1NB9A 3BH4A 1G7SA 1QH0A 2YWFA 3B82A 3Q3AA 4RD2A 1QVGB 1YIJB 4YEJA 1V0EA 2BM1A 2VBVA 5HXBA 4ZCMA 4LBYA 1N0VC 4RDLA 1WDTA 4QFMA 3PUMA 2D3LA 5KNLA 1QGYA 2CRVA 4C43A 1QVFB 1UD3A 5FNZA 3WNCA 4NNJA 4MYUA 4YAUA 4NBSA 1E43A 2B7BA 4X7FA 3T53B 4B3GA 1ZM3A 4OPOA 4GQNA 4PAAA 4UZFA 1BLIA 3GVLA 3OPOA 1VHOA 1YJWB 1VQ5B 1D2EA 3OW7A 4Z4TA 5GV8A 3ONUA 5IYWA 1OHHA 2V7XA 2X0KA 2JIZA 4P3YA 4ROXA 2E1BA 2PIAA 2V7TA 2X8KA 4X0CA 1CNFA 1VLYA 4XOPA 4P12A 4U9UA 2WPDA 2DEUA 1FNMA 5IYNA 2ZZQA 3CC2B 4XD7A 4XOTA 1PJ5A 3BCFA 3WYAA 4XLEA 2F4NA 1PJ6A 3R6JA 2FVGA 3QSYA 2XNDA 5KW9A 1RQPA 4X05A 4XL9A 1E1QA 2ZL7A 1DG1G 3VO1A 1Q82D 1Q81D 3W5UA 3CW2A 3VR6A 1JB9A 1UMKA 2E1RA 2OBTA 3JU4A 2CK3A 4CQJA 4MYTA 1K8AD 3JQPA 2BMWA 1EP1B 4E0FA 2XZLA 3SJPA 5FO1A 4P9SA 1VQPB 2Q6LA 3ZPNA 3SEJA 4OPSA 2EFGA 4IW3B 3T56B 1VF7A 3ES9A 4XQFA 1GVHA 2M5SA 4YELA 1TTTA 2X85A 4M53A 1CNEA 2QDXA 2Z6BD 4P3IA 3BC9A 4WWVA 1N0UA 4N3GA 3CTAA 1E62A 4P1VA 3CMEB 1PKVA 2NV4A 5FO0A 1KMHA 2V31A 4X7EA 1XFOA 1FDRA 2ZBVA 2QN6A 2PLFA 4R71A 3ZIAA 1FRNA 2GQFA 4Z4SA 3GSIA 2HDNB 4LBZA 1OB2A 3ISXA 3PENA 1EFUA 1WOPA 2XNJA 5TY0A 1VQ6B 2HMAA 2RC5A 3ASQA 5FL7A 2AHOA 1R5NA 3A3BA 3B78A 3AVUA 4M1KA 5B6IA 3VMFA 1JNYA 3WQZA 4XONA 1FNBA 3HAGA 3BQJA 4C0SA 1UD8A 2D74A 4WZTA 2ZITA 2R6HA 4G7XA 1XB2A 2XNCA 4YXWA 3JQRA 2OTJB 3OE7A 2QMUA 1IB0A 4EH1A 1WSRA 4RD0A 1MABA 3W5HA 4XLFA 4AF7A 4AVZA 3A8IA 5DN6A 1EFCA 3Q6RA 2FX3A 4HE6A 4BPRA 1WOSA 2XZPA 1KZLA 2BGJA 4XKVA 5IK2A 2QEXB 1ZM2A 2BF4A 2VNHA 2GJRA 1WP6A 1OGJA 4XNFA 2VNKA 4ACAA 3B8HA 4Z4WA 1Q7YD 3ZZUA 5LMZA 1SM4A 1IJFA 5IYQA 3WNBA 4P6YA 2BPOA 1FX0A 4Z4UA 1QX4A 3FJOA 3OKXA 1BPLA 4UAJA 1OB0A 1A8PA 1W87A 2CC2A 3Q6QA 3W2FA 2ZZEA 4P26A 3CB4A 5KSWB 2BSAA 3OP1A 1N08A 4KKUA 1QGAA 4II2A 1FNCA 1QFZA 2VJIA 1KTVA 3ASPA 4PGOA 1VQ4B 1ZUNB 3V76A 3BY1A 3QFTA 3OEEA 4B48A 4YALA 2VJJA 1R5OA 4Z4ZA 3CPWB 3U6BA 4XLHA 4PABA 4OOSA 1RQRA 3CCQB 1VQMB 4K1XA 4P25A 3W2HA 4PC1A 1S4MA 1KRHA 3WY9A 5A8AA 3PVDA 4HE5A 4B43A 3QE2A 1KK0A 3WBJA 2C4UA 1H85A 1Q9SA 4Y7CA 1H8EA 3KEWA 1DDGA 2HLDA 3KL9A 3Q38A 2OBSA 4WZEA 2ZXIA 2QGGA 3CCRB 3CP8A 4RCYA 1G7TA 2ZZGA 3WXMA 1WTHD 3AVVA 2BVNA 1KC8D 2PE3A 2V7QA 4Y9RA 1W0KA 2EIXA 3CD6B 3CPXA 1VQ8B 4RM0A 3ASTA 4PC7A 2XGJA 4RJLA 2OBRA 4N3NA 3G05A 4RD4A 1GAWA 1N06A 2C2WA 2DIEA 3FPKA 1W9XA 4G5GA 4Q7JB 4RLZA 1HZEA 2QE7A 1Y0YA 1S72B 3H94A 4WZLA 1OB5A 3GVKA 2GK6A 1GAQA 4TMVA 4B3FX 4FN5A 4H9GA 1J9ZA 1NB0A 4B3XA 2W6JA 4DNTB 4YHBA 4OP7A 2WJYA 4Y9UA 5IYRA 3CRZA 1G7RA 3JQQA 3AGPA 2P3MA 3OJXA 1H42A 3I55B 2Q6OA 2X6WA 3OZVA 3AVTA 1UD4A 4PC2A 4P22A 3SLNA 1AIPA 1WPCA 2NPFA 4ZV4A 1S0UA 4XR6A 2BM0A 4X07A 1E3XA 2DCUA 3A1PA 3CESA 2W6IA 2RC6A 1OGIA 3ONYA 4ZGNB 1VQOB 4FXUA 5E6TA 5A89A 1VQ9B 1E64A 1WOOA 3CXCB 1KJZA 4LBWA 1QUEA 5CDFA 5F4OA 3PUNA 2GREA 4XKWA 4DK0A 4G7WA 5THXA 3LO8A 1B23P 3QFSA 1GO2A 3T51B 1BMFA 1I18A 1GJRA 1ZM9A 1YX2A 1HA3A 1IHMA 2HCJB 3QFCA 2F43A 3V7AA 1F60A 4RCZA 2X53S 2JJ1A 1WSVA 5H59A 5HZAA 4KKSA 3SKBA 3FPPA 3VO2A 3GVJA 2PMDA 1VLOA 5DS0A 1EP2B 1XQBA 4QVAA 2VBTA 3P26A 4RPBA 2YWHA 1QGZA 4NCNA 3ZZTA 3BY2A 2C77A 4II3A 4QHYA 4QUZA 5FA6A 4DQKA 3ZZ0A 4X8IA 4XM3A 4X06A 3D26A 5FIUA 1W0JA 4TMXA 1BX0A 4TSFA 3LQ6A 1MRZA 3RY8A 1COWA 2WYRA 2X6XA 1TLLA 3ZUGA 3WBKA 4LC0A 1W34A 5DSZA 1YJNB 1HVXA 2WR8A 1D8TA 1V0FA 2F1LA 5L46A 3OW2B 1K73D 1P4MA 2VZLA 3I1FA 3GQBA 2D3NA 1EFRA 3OOCA 1FNDA 2CNDA 1JJ2B 2R9VA 2V7UA 1FRQA 4AC9A 3AVWA 2CBXA 1NRKA 2F1MA 2JDIA 1ZM4A 5IYPA 3DDYA 3W2IA 4G1VA 1N07A 5TV2A 1E79A 3CCUB 4XLAA 4HIZA 4B47A 4X7CA 1ELOA 3OJWA 1YJ9B 3G4SB 1KK2A 1H8HA 1QFJA 1TUIA 2OYNA 1NBMA 3LQEA 4TMZA 4ZCIA 2DERA 3VNUA 4OPVA 4X7DA 3OAAA 4RDKA 2VNJA 3H9NA 4L8JA 3Q39A 1WU8A 4M4SA 4TMWA 1R5BA 2WSSA 3U2QA 1UD2A 2YWEA 2QA4B 1K9MD 3NE5B 3R6KA 4ZCLA 4YAFA 3ASSA 5F4JA 3OFNA 4DNRB 2BGIA 4YAWA 2QTZA 4RD3A 3ZBTA 4JMQA 1NJID 2CF4A 3W5VA 2DY1A 4OOXA 1U2RA 4F7DA 1DDIA 1SKYB 1UD5A 2BN4A 4TKOB 1AMOA 1CQXA 3MMPA 5GV7A 5A88A 1T5EA 1N8RD 1SKQA 3SJZA 2QTLA 2Q6IA 3QFRA 3J81k 3W2GA 1KQSB 3ZC3A 2XOKA 4WQMA 4M2LA 4M0LA 1XE1A 2GJKA 4G1BA 4XN0A 2ZL5A 2V7WA 2DETA 3CMMA 4PC3A 1M90D 1W2BB 2ZZFA 3AVYA 1IJEA 1M1KD 2C5HA 1G7CA 3AGQA 4Z4VA 2WZNA 3WNDA 2WJVA 4XMYA 4ZGQB 1YITB 1E3ZA 1YHQB 4TN1A 3CCJB 2J7KA 2ZL6A 3A35A 3CCVB 3SLDA 1YI2B 1E63A 2GPJA 4G6IA 3ZBUA 4B44A 1VQLB 1QG0A 3I56B 5AN9A 5BSXA 4Z4YA 4AF6A 3E20A 4Z1MA 1EP3B 4P6VF 4UZUA 5JBQA 1VQ7B 1BQEA 2B5OA 4B4DA 4ACBA 2DYIA 3A8JA 4KKTA 1B2RA 1T6YA 2JN9A 1GR1A 2X3UA 3A8KA 1KK1A 3FKSA 1NDHA 3GIRA 3AVXA 2X6YA 2ZXHA 4UZEA 4XN3A 3PA2A 1YLOA 2WZPP 2I1LA 3OEHA 4J0QA 3CMAB 1V5VA 1E1RA 4ASUA 3BNWA 2OTLB 1DARA
chains in the Genus database with same CATH topology
2D9RA 2NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9R A; 
#chains in the Genus database with same CATH topology
 1WOR A;  5J35 A;  5F4M A;  3OZW A;  1VHE A;  2LZJ A;  2VBS A;  2YWG A;  3BCD A;  5BSY A;  2ZTN A;  3MHP A;  1Q86 D;  1N05 A;  4DQL A;  3CCS B;  1QFY A;  2C5B A;  4TMT A;  1W35 A;  2BV3 A;  3OZU A;  2C78 A;  2VNI A;  1F20 A;  3LVB A;  3CC7 B;  5H5J A;  4TT3 A;  3E1Y E;  2V7V A;  2B7C A;  3PA1 A;  3W2E A;  2V4D A;  2DOG A;  1KK3 A;  5HZB A;  1TVC A;  2GK7 A;  3CCM B;  4P2N A;  1I7P A;  5J3O A;  2VBU A;  3ASR A;  3CCL B;  4QV2 A;  3CCE B;  4QVJ A;  4RPD A;  1I8D A;  5HKK A;  2D9R A;  5TRD A;  4XLC A;  2OK7 A;  4LBV A;  1EWY A;  2JJ2 A;  1KD1 D;  4RDJ A;  4FK8 A;  4XOR A;  4Z4R A;  3CC4 B;  1T6Z A;  1VQN B;  1T6X A;  3P27 A;  2ZBU A;  1Y0R A;  4FWT A;  1JA0 A;  1BX1 A;  5TR9 A;  1PJ7 A;  2XEX A;  3A3G A;  1JA1 A;  1EFT A;  2GJP A;  4WZK A;  1D1N A;  4DK1 A;  1VJS A;  5EMN A;  3MCA A;  3G71 B;  2VYQ A;  3G6E B;  2ZTG A;  3VNV A;  1K28 D;  3U6K A;  2OK8 A;  1VQK B;  2Q6K A;  4YAO A;  1QUF A;  4OOV A;  2C4T A;  3LNN A;  1BJK A;  2CW5 A;  3CP2 A;  4RD1 A;  4PC6 A;  2XZO A;  1UD6 A;  1EXM A;  2KVO A;  4RD6 A;  1NB9 A;  3BH4 A;  1G7S A;  1QH0 A;  2YWF A;  3B82 A;  3Q3A A;  4RD2 A;  1QVG B;  1YIJ B;  4YEJ A;  1V0E A;  2BM1 A;  2VBV A;  5HXB A;  4ZCM A;  4LBY A;  1N0V C;  4RDL A;  1WDT A;  4QFM A;  3PUM A;  2D3L A;  5KNL A;  1QGY A;  2CRV A;  4C43 A;  1QVF B;  1UD3 A;  5FNZ A;  3WNC A;  4NNJ A;  4MYU A;  4YAU A;  4NBS A;  1E43 A;  2B7B A;  4X7F A;  3T53 B;  4B3G A;  1ZM3 A;  4OPO A;  4GQN A;  4PAA A;  4UZF A;  1BLI A;  3GVL A;  3OPO A;  1VHO A;  1YJW B;  1VQ5 B;  1D2E A;  3OW7 A;  4Z4T A;  5GV8 A;  3ONU A;  5IYW A;  1OHH A;  2V7X A;  2X0K A;  2JIZ A;  4P3Y A;  4ROX A;  2E1B A;  2PIA A;  2V7T A;  2X8K A;  4X0C A;  1CNF A;  1VLY A;  4XOP A;  4P12 A;  4U9U A;  2WPD A;  2DEU A;  1FNM A;  5IYN A;  2ZZQ A;  3CC2 B;  4XD7 A;  4XOT A;  1PJ5 A;  3BCF A;  3WYA A;  4XLE A;  2F4N A;  1PJ6 A;  3R6J A;  2FVG A;  3QSY A;  2XND A;  5KW9 A;  1RQP A;  4X05 A;  4XL9 A;  1E1Q A;  2ZL7 A;  1DG1 G;  3VO1 A;  1Q82 D;  1Q81 D;  3W5U A;  3CW2 A;  3VR6 A;  1JB9 A;  1UMK A;  2E1R A;  2OBT A;  3JU4 A;  2CK3 A;  4CQJ A;  4MYT A;  1K8A D;  3JQP A;  2BMW A;  1EP1 B;  4E0F A;  2XZL A;  3SJP A;  5FO1 A;  4P9S A;  1VQP B;  2Q6L A;  3ZPN A;  3SEJ A;  4OPS A;  2EFG A;  4IW3 B;  3T56 B;  1VF7 A;  3ES9 A;  4XQF A;  1GVH A;  2M5S A;  4YEL A;  1TTT A;  2X85 A;  4M53 A;  1CNE A;  2QDX A;  2Z6B D;  4P3I A;  3BC9 A;  4WWV A;  1N0U A;  4N3G A;  3CTA A;  1E62 A;  4P1V A;  3CME B;  1PKV A;  2NV4 A;  5FO0 A;  1KMH A;  2V31 A;  4X7E A;  1XFO A;  1FDR A;  2ZBV A;  2QN6 A;  2PLF A;  4R71 A;  3ZIA A;  1FRN A;  2GQF A;  4Z4S A;  3GSI A;  2HDN B;  4LBZ A;  1OB2 A;  3ISX A;  3PEN A;  1EFU A;  1WOP A;  2XNJ A;  5TY0 A;  1VQ6 B;  2HMA A;  2RC5 A;  3ASQ A;  5FL7 A;  2AHO A;  1R5N A;  3A3B A;  3B78 A;  3AVU A;  4M1K A;  5B6I A;  3VMF A;  1JNY A;  3WQZ A;  4XON A;  1FNB A;  3HAG A;  3BQJ A;  4C0S A;  1UD8 A;  2D74 A;  4WZT A;  2ZIT A;  2R6H A;  4G7X A;  1XB2 A;  2XNC A;  4YXW A;  3JQR A;  2OTJ B;  3OE7 A;  2QMU A;  1IB0 A;  4EH1 A;  1WSR A;  4RD0 A;  1MAB A;  3W5H A;  4XLF A;  4AF7 A;  4AVZ A;  3A8I A;  5DN6 A;  1EFC A;  3Q6R A;  2FX3 A;  4HE6 A;  4BPR A;  1WOS A;  2XZP A;  1KZL A;  2BGJ A;  4XKV A;  5IK2 A;  2QEX B;  1ZM2 A;  2BF4 A;  2VNH A;  2GJR A;  1WP6 A;  1OGJ A;  4XNF A;  2VNK A;  4ACA A;  3B8H A;  4Z4W A;  1Q7Y D;  3ZZU A;  5LMZ A;  1SM4 A;  1IJF A;  5IYQ A;  3WNB A;  4P6Y A;  2BPO A;  1FX0 A;  4Z4U A;  1QX4 A;  3FJO A;  3OKX A;  1BPL A;  4UAJ A;  1OB0 A;  1A8P A;  1W87 A;  2CC2 A;  3Q6Q A;  3W2F A;  2ZZE A;  4P26 A;  3CB4 A;  5KSW B;  2BSA A;  3OP1 A;  1N08 A;  4KKU A;  1QGA A;  4II2 A;  1FNC A;  1QFZ A;  2VJI A;  1KTV A;  3ASP A;  4PGO A;  1VQ4 B;  1ZUN B;  3V76 A;  3BY1 A;  3QFT A;  3OEE A;  4B48 A;  4YAL A;  2VJJ A;  1R5O A;  4Z4Z A;  3CPW B;  3U6B A;  4XLH A;  4PAB A;  4OOS A;  1RQR A;  3CCQ B;  1VQM B;  4K1X A;  4P25 A;  3W2H A;  4PC1 A;  1S4M A;  1KRH A;  3WY9 A;  5A8A A;  3PVD A;  4HE5 A;  4B43 A;  3QE2 A;  1KK0 A;  3WBJ A;  2C4U A;  1H85 A;  1Q9S A;  4Y7C A;  1H8E A;  3KEW A;  1DDG A;  2HLD A;  3KL9 A;  3Q38 A;  2OBS A;  4WZE A;  2ZXI A;  2QGG A;  3CCR B;  3CP8 A;  4RCY A;  1G7T A;  2ZZG A;  3WXM A;  1WTH D;  3AVV A;  2BVN A;  1KC8 D;  2PE3 A;  2V7Q A;  4Y9R A;  1W0K A;  2EIX A;  3CD6 B;  3CPX A;  1VQ8 B;  4RM0 A;  3AST A;  4PC7 A;  2XGJ A;  4RJL A;  2OBR A;  4N3N A;  3G05 A;  4RD4 A;  1GAW A;  1N06 A;  2C2W A;  2DIE A;  3FPK A;  1W9X A;  4G5G A;  4Q7J B;  4RLZ A;  1HZE A;  2QE7 A;  1Y0Y A;  1S72 B;  3H94 A;  4WZL A;  1OB5 A;  3GVK A;  2GK6 A;  1GAQ A;  4TMV A;  4B3F X;  4FN5 A;  4H9G A;  1J9Z A;  1NB0 A;  4B3X A;  2W6J A;  4DNT B;  4YHB A;  4OP7 A;  2WJY A;  4Y9U A;  5IYR A;  3CRZ A;  1G7R A;  3JQQ A;  3AGP A;  2P3M A;  3OJX A;  1H42 A;  3I55 B;  2Q6O A;  2X6W A;  3OZV A;  3AVT A;  1UD4 A;  4PC2 A;  4P22 A;  3SLN A;  1AIP A;  1WPC A;  2NPF A;  4ZV4 A;  1S0U A;  4XR6 A;  2BM0 A;  4X07 A;  1E3X A;  2DCU A;  3A1P A;  3CES A;  2W6I A;  2RC6 A;  1OGI A;  3ONY A;  4ZGN B;  1VQO B;  4FXU A;  5E6T A;  5A89 A;  1VQ9 B;  1E64 A;  1WOO A;  3CXC B;  1KJZ A;  4LBW A;  1QUE A;  5CDF A;  5F4O A;  3PUN A;  2GRE A;  4XKW A;  4DK0 A;  4G7W A;  5THX A;  3LO8 A;  1B23 P;  3QFS A;  1GO2 A;  3T51 B;  1BMF A;  1I18 A;  1GJR A;  1ZM9 A;  1YX2 A;  1HA3 A;  1IHM A;  2HCJ B;  3QFC A;  2F43 A;  3V7A A;  1F60 A;  4RCZ A;  2X53 S;  2JJ1 A;  1WSV A;  5H59 A;  5HZA A;  4KKS A;  3SKB A;  3FPP A;  3VO2 A;  3GVJ A;  2PMD A;  1VLO A;  5DS0 A;  1EP2 B;  1XQB A;  4QVA A;  2VBT A;  3P26 A;  4RPB A;  2YWH A;  1QGZ A;  4NCN A;  3ZZT A;  3BY2 A;  2C77 A;  4II3 A;  4QHY A;  4QUZ A;  5FA6 A;  4DQK A;  3ZZ0 A;  4X8I A;  4XM3 A;  4X06 A;  3D26 A;  5FIU A;  1W0J A;  4TMX A;  1BX0 A;  4TSF A;  3LQ6 A;  1MRZ A;  3RY8 A;  1COW A;  2WYR A;  2X6X A;  1TLL A;  3ZUG A;  3WBK A;  4LC0 A;  1W34 A;  5DSZ A;  1YJN B;  1HVX A;  2WR8 A;  1D8T A;  1V0F A;  2F1L A;  5L46 A;  3OW2 B;  1K73 D;  1P4M A;  2VZL A;  3I1F A;  3GQB A;  2D3N A;  1EFR A;  3OOC A;  1FND A;  2CND A;  1JJ2 B;  2R9V A;  2V7U A;  1FRQ A;  4AC9 A;  3AVW A;  2CBX A;  1NRK A;  2F1M A;  2JDI A;  1ZM4 A;  5IYP A;  3DDY A;  3W2I A;  4G1V A;  1N07 A;  5TV2 A;  1E79 A;  3CCU B;  4XLA A;  4HIZ A;  4B47 A;  4X7C A;  1ELO A;  3OJW A;  1YJ9 B;  3G4S B;  1KK2 A;  1H8H A;  1QFJ A;  1TUI A;  2OYN A;  1NBM A;  3LQE A;  4TMZ A;  4ZCI A;  2DER A;  3VNU A;  4OPV A;  4X7D A;  3OAA A;  4RDK A;  2VNJ A;  3H9N A;  4L8J A;  3Q39 A;  1WU8 A;  4M4S A;  4TMW A;  1R5B A;  2WSS A;  3U2Q A;  1UD2 A;  2YWE A;  2QA4 B;  1K9M D;  3NE5 B;  3R6K A;  4ZCL A;  4YAF A;  3ASS A;  5F4J A;  3OFN A;  4DNR B;  2BGI A;  4YAW A;  2QTZ A;  4RD3 A;  3ZBT A;  4JMQ A;  1NJI D;  2CF4 A;  3W5V A;  2DY1 A;  4OOX A;  1U2R A;  4F7D A;  1DDI A;  1SKY B;  1UD5 A;  2BN4 A;  4TKO B;  1AMO A;  1CQX A;  3MMP A;  5GV7 A;  5A88 A;  1T5E A;  1N8R D;  1SKQ A;  3SJZ A;  2QTL A;  2Q6I A;  3QFR A;  3J81 k;  3W2G A;  1KQS B;  3ZC3 A;  2XOK A;  4WQM A;  4M2L A;  4M0L A;  1XE1 A;  2GJK A;  4G1B A;  4XN0 A;  2ZL5 A;  2V7W A;  2DET A;  3CMM A;  4PC3 A;  1M90 D;  1W2B B;  2ZZF A;  3AVY A;  1IJE A;  1M1K D;  2C5H A;  1G7C A;  3AGQ A;  4Z4V A;  2WZN A;  3WND A;  2WJV A;  4XMY A;  4ZGQ B;  1YIT B;  1E3Z A;  1YHQ B;  4TN1 A;  3CCJ B;  2J7K A;  2ZL6 A;  3A35 A;  3CCV B;  3SLD A;  1YI2 B;  1E63 A;  2GPJ A;  4G6I A;  3ZBU A;  4B44 A;  1VQL B;  1QG0 A;  3I56 B;  5AN9 A;  5BSX A;  4Z4Y A;  4AF6 A;  3E20 A;  4Z1M A;  1EP3 B;  4P6V F;  4UZU A;  5JBQ A;  1VQ7 B;  1BQE A;  2B5O A;  4B4D A;  4ACB A;  2DYI A;  3A8J A;  4KKT A;  1B2R A;  1T6Y A;  2JN9 A;  1GR1 A;  2X3U A;  3A8K A;  1KK1 A;  3FKS A;  1NDH A;  3GIR A;  3AVX A;  2X6Y A;  2ZXH A;  4UZE A;  4XN3 A;  3PA2 A;  1YLO A;  2WZP P;  2I1L A;  3OEH A;  4J0Q A;  3CMA B;  1V5V A;  1E1R A;  4ASU A;  3BNW A;  2OTL B;  1DAR A; 
#chains in the Genus database with same CATH homology
 2D9R A;  2NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...