2D9RA

Structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83]
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
molecule tags Structural genomics, unknown function
source organism Porphyromonas gingivalis
publication title Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]
rcsb
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08922 DUF1905 Domain of unknown function (DUF1905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.100 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 AF2212/PG0164-like 2d9rA00
2D9RA
chains in the Genus database with same CATH superfamily
1KQSB 1E79A 4P1VA 5B6IA 3G4SB 4WWVA 3CTAA 4X0CA 1N8RD 1H8EA 1KMHA 2ZL7A 3LO8A 4G1VA 4ZCIA 1B2RA 4WZKA 2OTLB 3WNBA 3CCSB 1F60A 4YEJA 1KK0A 3WQZA 1MABA 5H5JA 2RC5A 3AGQA 1S0UA 3R6JA 4XOTA 3D26A 4X7DA 4PC2A 4X7CA 4RD3A 4H9GA 3G05A 3P27A 1TUIA 2YWEA 1QGAA 3ASPA 3B78A 1COWA 3H94A 1RQPA 3SEJA 4RLZA 4TMVA 1WOOA 3LQ6A 4B3XA 2BGIA 2QA4B 5KNLA 4RD4A 4Y7CA 4QFMA 2W6IA 2WR8A 1BX0A 1YI2B 2V4DA 2ZZFA 4UAJA 5CDFA 3T51B 1BLIA 1E43A 4XKWA 3CCVB 2GJKA 2ZTGA 4RDKA 2XZLA 2ZL5A 3FPPA 1VHEA 1FNBA 1G7RA 2ZBVA 1E1RA 3VO1A 2CF4A 3QFRA 5E6TA 5IYNA 5L46A 1EP1B 2VNKA 3ZC3A 1SM4A 4RD1A 4L8JA 5H59A 3CCUB 5HXBA 1JA1A 5JBQA 4X06A 3Q6RA 4II3A 1NB0A 2ZXIA 3PENA 5KW9A 2FX3A 4QHYA 2OBTA 1E1QA 1N08A 2D74A 1FNCA 1VLOA 1QFZA 5DS0A 1VHOA 4XQFA 1XQBA 1YX2A 1VQ9B 3CD6B 1D1NA 2CNDA 4TMTA 1HZEA 1YJWB 4RD6A 2BMWA 2QN6A 2QTZA 4YAFA 1BX1A 1YIJB 4KKTA 3OAAA 4OOSA 3ZBTA 3OW2B 2WZPP 3Q38A 2DETA 4NCNA 3CP8A 4YELA 1W2BB 3W2FA 3B8HA 4N3GA 1K9MD 4XLHA 1BMFA 2HDNB 3VNUA 5FIUA 4BPRA 1KTVA 2XNCA 2WZNA 3W5VA 2WPDA 4M4SA 2WYRA 1W0KA 2CRVA 4XORA 1DARA 1N07A 1KRHA 3OZWA 4B4DA 5IYRA 3OP1A 4Y9UA 5F4MA 4XD7A 4P2NA 5EMNA 1OGJA 3ES9A 4X07A 2BGJA 2JJ2A 1VQ4B 1UD5A 2J7KA 2XZOA 1CQXA 1VQ5B 4CQJA 1DDGA 1QGZA 2NV4A 4TN1A 2GK6A 1N06A 2BV3A 2QDXA 2V7UA 3G6EB 3E20A 3CMMA 3A8IA 4AVZA 4K1XA 3T53B 4XONA 2YWGA 2X85A 1WSVA 2QGGA 1M90D 4DK1A 1BQEA 2EFGA 3QE2A 4OPOA 4Z4WA 1QH0A 2FVGA 1YJNB 2F1LA 5J3OA 1Y0YA 4M2LA 1BPLA 1VJSA 3ASSA 1H85A 1R5OA 2I1LA 1EXMA 3OEHA 1GO2A 2F1MA 1PJ6A 5THXA 4MYTA 5A89A 1HA3A 4MYUA 1UD4A 4XLFA 2R9VA 1EP3B 4DNRB 5J35A 1QUFA 4XOPA 4M53A 1FDRA 3FJOA 4M1KA 3ZBUA 4ZGQB 3OJWA 1RQRA 3LVBA 1SKQA 3W2EA 3ZZUA 4PC6A 2ZBUA 3OZVA 1H42A 2VBVA 2F43A 3BNWA 1Q86D 4TMZA 4Z4ZA 2GREA 2WSSA 2C5BA 4RPBA 3SLNA 3CCEB 1KJZA 2W6JA 2PMDA 3W2HA 1KK3A 4TMWA 3LNNA 2P3MA 4RD0A 2QEXB 1PJ7A 3PUNA 2X6YA 4ROXA 3V7AA 1Y0RA 3CW2A 4Z4YA 4TKOB 4UZUA 2OBRA 3OOCA 5FL7A 2DERA 1V5VA 4XLEA 2X6WA 4U9UA 3VO2A 2B5OA 4Z4SA 3ONUA 5IYPA 3AVXA 3R6KA 4NBSA 1XB2A 3B82A 5IYQA 2BM0A 2PIAA 1ELOA 3PA1A 2XNJA 1QFJA 4YHBA 3CCQB 4FWTA 1VQLB 1FRQA 3OPOA 2Q6OA 4J0QA 4OOVA 4TMXA 2RC6A 2QMUA 2C4UA 1VQPB 1OGIA 3CC2B 3CRZA 3P26A 4QVJA 3ISXA 3LQEA 4G5GA 4LBVA 1H8HA 3U6BA 3FKSA 3MHPA 1J9ZA 1ZM9A 3QSYA 1OB0A 5DSZA 4C43A 2JIZA 1KK2A 2V7XA 1TVCA 4IW3B 2D3LA 5HZAA 5LMZA 4OPSA 3ZZTA 1YITB 2C78A 3A8JA 1XFOA 4B43A 3OJXA 2DEUA 4YALA 1IJFA 1W34A 3ASQA 1JA0A 2WJYA 4PC7A 5TRDA 5AN9A 4HE5A 2BF4A 3W5UA 1YHQB 1G7CA 1Q7YD 1S4MA 4WZEA 3W5HA 2GJRA 4X7EA 4QVAA 4XKVA 3WYAA 3GVJA 4FXUA 1VQ8B 3PUMA 4ACBA 3GVKA 3W2IA 3GIRA 2ZZGA 4XLAA 4P9SA 3BCFA 1NJID 2OK8A 2VNHA 4P3YA 3PVDA 2Z6BD 4RCYA 1TTTA 4JMQA 4RD2A 1I8DA 4DQKA 2Q6IA 4DK0A 2XEXA 3SLDA 3VR6A 4LBWA 1VQNB 4Z4UA 4HIZA 2X3UA 1NBMA 3JQPA 2Q6KA 1KD1D 4RPDA 5KSWB 4ZCLA 1UMKA 5F4JA 1W9XA 1F20A 2E1RA 1WSRA 1ZUNB 2DCUA 1GVHA 4LBZA 3W2GA 4M0LA 1P4MA 1WOSA 2CBXA 1T6XA 1JNYA 1QVFB 3A3GA 3CESA 3V76A 3ONYA 3ZUGA 3CCRB 3BY2A 4ZV4A 1N05A 2VZLA 1QG0A 2XNDA 2ZL6A 2BN4A 1V0FA 3WNDA 1YLOA 2OYNA 1E62A 2JN9A 1MRZA 3CB4A 1QVGB 4WZTA 1UD3A 1W35A 4YAUA 3QFTA 1CNEA 4WZLA 3QFSA 3BY1A 4ACAA 1KK1A 1OB5A 1A8PA 4Z4TA 3AVWA 3CMEB 3A35A 1TLLA 5DN6A 4X7FA 5BSYA 1WU8A 1IHMA 4PC3A 1WDTA 3T56B 4P12A 5FNZA 3JU4A 1KC8D 3CXCB 1WP6A 3SJZA 5TR9A 3KL9A 2GJPA 2CW5A 3BQJA 4YAWA 3CC7B 1DDIA 2DY1A 4X05A 5FO0A 1WTHD 3WBKA 4ZCMA 2KVOA 3WBJA 2DYIA 1WPCA 1WORA 4RJLA 4NNJA 1M1KD 4AC9A 3H9NA 3A3BA 1T6ZA 2PLFA 3Q3AA 4Z4RA 3BH4A 3BC9A 1I18A 2BM1A 3I1FA 3ZIAA 1FNDA 1SKYB 2C5HA 4E0FA 4XL9A 3ZZ0A 1JJ2B 4TT3A 5GV8A 2ZZEA 2B7CA 4G7XA 4XN3A 1AIPA 3OKXA 1UD2A 3VMFA 3WY9A 2M5SA 2YWFA 4XR6A 3I56B 2X53S 4PAAA 1T6YA 3GQBA 3CPWB 5F4OA 4YXWA 4UZFA 1K8AD 1E63A 3QFCA 4WQMA 2GK7A 2VBUA 2PE3A 4OOXA 4QV2A 4X8IA 3CP2A 4RDLA 3OE7A 1NDHA 1QX4A 2OTJB 1HVXA 4B47A 1XE1A 4B48A 1IB0A 1VQKB 4P26A 4OPVA 4YAOA 3WXMA 2DIEA 2HMAA 3KEWA 1OB2A 2VBSA 1PJ5A 4PABA 4KKUA 1N0UA 5TY0A 4AF6A 4GQNA 3AVTA 3MCAA 5A88A 4XNFA 1QGYA 5FA6A 2GQFA 3CCMB 4PGOA 1CNFA 2XOKA 2F4NA 2JJ1A 2OBSA 4QUZA 1B23P 3AVVA 3OW7A 1GR1A 2LZJA 4XLCA 4C0SA 3OEEA 4LC0A 5BSXA 2X0KA 3U6KA 2VYQA 4XM3A 1VQMB 1QFYA 3E1YE 4N3NA 2CK3A 3FPKA 1VF7A 4P6VF 4EH1A 1YJ9B 3CMAB 2ZITA 2XZPA 2WJVA 4LBYA 4OP7A 4G6IA 1FX0A 1EWYA 1FRNA 3GSIA 4XN0A 4PC1A 1VQ6B 3CPXA 2QE7A 5TV2A 2YWHA 2V31A 4FN5A 2BVNA 3AVUA 1EFCA 1V0EA 2GPJA 1I7PA 4XMYA 3RY8A 4P25A 2HCJB 3DDYA 1ZM3A 5GV7A 1K28D 1D8TA 2XGJA 1UD6A 4KKSA 1IJEA 2C77A 4F7DA 3G71B 3I55B 1EP2B 1BJKA 2D3NA 3MMPA 5A8AA 1UD8A 1OHHA 2DOGA 2VNIA 4P6YA 2ZXHA 2X6XA 4DNTB 2Q6LA 3OFNA 2V7TA 1Q9SA 1W0JA 4UZEA 3OZUA 4Z1MA 4R71A 3Q6QA 2OK7A 4AF7A 1WOPA 2BSAA 3HAGA 1R5BA 3SJPA 2R6HA 1ZM4A 4FK8A 5HZBA 3NE5B 2D9RA 2V7VA 1EFRA 1GAQA 1N0VC 2V7QA 1K73D 2C2WA 1NRKA 5IYWA 1GAWA 1PKVA 1AMOA 5HKKA 2HLDA 1NB9A 1GJRA 4B44A 3AVYA 2VBTA 2VJJA 3BCDA 4B3FX 3ASRA 1U2RA 4RDJA 1EFTA 2C4TA 4Y9RA 1Q82D 1EFUA 1E3ZA 1E3XA 4RCZA 1ZM2A 1E64A 1D2EA 1T5EA 3PA2A 1G7TA 3JQQA 3AGPA 3ASTA 4HE6A 5FO1A 2NPFA 4TSFA 3VNVA 1VQOB 4Z4VA 4G7WA 2ZZQA 2E1BA 4B3GA 4P3IA 5IK2A 4ASUA 4G1BA 2B7BA 2EIXA 3WNCA 1FNMA 3CCJB 1Q81D 3SKBA 4RM0A 1G7SA 1QUEA 1W87A 3A1PA 4P22A 3J81k 2X8KA 2V7WA 2VNJA 2QTLA 1KZLA 2CC2A 4Q7JB 1VQ7B 1VLYA 2ZTNA 3CCLB 4ZGNB 1JB9A 2VJIA 2AHOA 3U2QA 4DQLA 1S72B 1DG1G 2JDIA 3GVLA 3CC4B 3JQRA 4II2A 3ZPNA 3Q39A 2BPOA 1R5NA 3A8KA
chains in the Genus database with same CATH topology
2D9RA 2NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9R A; 
#chains in the Genus database with same CATH topology
 1KQS B;  1E79 A;  4P1V A;  5B6I A;  3G4S B;  4WWV A;  3CTA A;  4X0C A;  1N8R D;  1H8E A;  1KMH A;  2ZL7 A;  3LO8 A;  4G1V A;  4ZCI A;  1B2R A;  4WZK A;  2OTL B;  3WNB A;  3CCS B;  1F60 A;  4YEJ A;  1KK0 A;  3WQZ A;  1MAB A;  5H5J A;  2RC5 A;  3AGQ A;  1S0U A;  3R6J A;  4XOT A;  3D26 A;  4X7D A;  4PC2 A;  4X7C A;  4RD3 A;  4H9G A;  3G05 A;  3P27 A;  1TUI A;  2YWE A;  1QGA A;  3ASP A;  3B78 A;  1COW A;  3H94 A;  1RQP A;  3SEJ A;  4RLZ A;  4TMV A;  1WOO A;  3LQ6 A;  4B3X A;  2BGI A;  2QA4 B;  5KNL A;  4RD4 A;  4Y7C A;  4QFM A;  2W6I A;  2WR8 A;  1BX0 A;  1YI2 B;  2V4D A;  2ZZF A;  4UAJ A;  5CDF A;  3T51 B;  1BLI A;  1E43 A;  4XKW A;  3CCV B;  2GJK A;  2ZTG A;  4RDK A;  2XZL A;  2ZL5 A;  3FPP A;  1VHE A;  1FNB A;  1G7R A;  2ZBV A;  1E1R A;  3VO1 A;  2CF4 A;  3QFR A;  5E6T A;  5IYN A;  5L46 A;  1EP1 B;  2VNK A;  3ZC3 A;  1SM4 A;  4RD1 A;  4L8J A;  5H59 A;  3CCU B;  5HXB A;  1JA1 A;  5JBQ A;  4X06 A;  3Q6R A;  4II3 A;  1NB0 A;  2ZXI A;  3PEN A;  5KW9 A;  2FX3 A;  4QHY A;  2OBT A;  1E1Q A;  1N08 A;  2D74 A;  1FNC A;  1VLO A;  1QFZ A;  5DS0 A;  1VHO A;  4XQF A;  1XQB A;  1YX2 A;  1VQ9 B;  3CD6 B;  1D1N A;  2CND A;  4TMT A;  1HZE A;  1YJW B;  4RD6 A;  2BMW A;  2QN6 A;  2QTZ A;  4YAF A;  1BX1 A;  1YIJ B;  4KKT A;  3OAA A;  4OOS A;  3ZBT A;  3OW2 B;  2WZP P;  3Q38 A;  2DET A;  4NCN A;  3CP8 A;  4YEL A;  1W2B B;  3W2F A;  3B8H A;  4N3G A;  1K9M D;  4XLH A;  1BMF A;  2HDN B;  3VNU A;  5FIU A;  4BPR A;  1KTV A;  2XNC A;  2WZN A;  3W5V A;  2WPD A;  4M4S A;  2WYR A;  1W0K A;  2CRV A;  4XOR A;  1DAR A;  1N07 A;  1KRH A;  3OZW A;  4B4D A;  5IYR A;  3OP1 A;  4Y9U A;  5F4M A;  4XD7 A;  4P2N A;  5EMN A;  1OGJ A;  3ES9 A;  4X07 A;  2BGJ A;  2JJ2 A;  1VQ4 B;  1UD5 A;  2J7K A;  2XZO A;  1CQX A;  1VQ5 B;  4CQJ A;  1DDG A;  1QGZ A;  2NV4 A;  4TN1 A;  2GK6 A;  1N06 A;  2BV3 A;  2QDX A;  2V7U A;  3G6E B;  3E20 A;  3CMM A;  3A8I A;  4AVZ A;  4K1X A;  3T53 B;  4XON A;  2YWG A;  2X85 A;  1WSV A;  2QGG A;  1M90 D;  4DK1 A;  1BQE A;  2EFG A;  3QE2 A;  4OPO A;  4Z4W A;  1QH0 A;  2FVG A;  1YJN B;  2F1L A;  5J3O A;  1Y0Y A;  4M2L A;  1BPL A;  1VJS A;  3ASS A;  1H85 A;  1R5O A;  2I1L A;  1EXM A;  3OEH A;  1GO2 A;  2F1M A;  1PJ6 A;  5THX A;  4MYT A;  5A89 A;  1HA3 A;  4MYU A;  1UD4 A;  4XLF A;  2R9V A;  1EP3 B;  4DNR B;  5J35 A;  1QUF A;  4XOP A;  4M53 A;  1FDR A;  3FJO A;  4M1K A;  3ZBU A;  4ZGQ B;  3OJW A;  1RQR A;  3LVB A;  1SKQ A;  3W2E A;  3ZZU A;  4PC6 A;  2ZBU A;  3OZV A;  1H42 A;  2VBV A;  2F43 A;  3BNW A;  1Q86 D;  4TMZ A;  4Z4Z A;  2GRE A;  2WSS A;  2C5B A;  4RPB A;  3SLN A;  3CCE B;  1KJZ A;  2W6J A;  2PMD A;  3W2H A;  1KK3 A;  4TMW A;  3LNN A;  2P3M A;  4RD0 A;  2QEX B;  1PJ7 A;  3PUN A;  2X6Y A;  4ROX A;  3V7A A;  1Y0R A;  3CW2 A;  4Z4Y A;  4TKO B;  4UZU A;  2OBR A;  3OOC A;  5FL7 A;  2DER A;  1V5V A;  4XLE A;  2X6W A;  4U9U A;  3VO2 A;  2B5O A;  4Z4S A;  3ONU A;  5IYP A;  3AVX A;  3R6K A;  4NBS A;  1XB2 A;  3B82 A;  5IYQ A;  2BM0 A;  2PIA A;  1ELO A;  3PA1 A;  2XNJ A;  1QFJ A;  4YHB A;  3CCQ B;  4FWT A;  1VQL B;  1FRQ A;  3OPO A;  2Q6O A;  4J0Q A;  4OOV A;  4TMX A;  2RC6 A;  2QMU A;  2C4U A;  1VQP B;  1OGI A;  3CC2 B;  3CRZ A;  3P26 A;  4QVJ A;  3ISX A;  3LQE A;  4G5G A;  4LBV A;  1H8H A;  3U6B A;  3FKS A;  3MHP A;  1J9Z A;  1ZM9 A;  3QSY A;  1OB0 A;  5DSZ A;  4C43 A;  2JIZ A;  1KK2 A;  2V7X A;  1TVC A;  4IW3 B;  2D3L A;  5HZA A;  5LMZ A;  4OPS A;  3ZZT A;  1YIT B;  2C78 A;  3A8J A;  1XFO A;  4B43 A;  3OJX A;  2DEU A;  4YAL A;  1IJF A;  1W34 A;  3ASQ A;  1JA0 A;  2WJY A;  4PC7 A;  5TRD A;  5AN9 A;  4HE5 A;  2BF4 A;  3W5U A;  1YHQ B;  1G7C A;  1Q7Y D;  1S4M A;  4WZE A;  3W5H A;  2GJR A;  4X7E A;  4QVA A;  4XKV A;  3WYA A;  3GVJ A;  4FXU A;  1VQ8 B;  3PUM A;  4ACB A;  3GVK A;  3W2I A;  3GIR A;  2ZZG A;  4XLA A;  4P9S A;  3BCF A;  1NJI D;  2OK8 A;  2VNH A;  4P3Y A;  3PVD A;  2Z6B D;  4RCY A;  1TTT A;  4JMQ A;  4RD2 A;  1I8D A;  4DQK A;  2Q6I A;  4DK0 A;  2XEX A;  3SLD A;  3VR6 A;  4LBW A;  1VQN B;  4Z4U A;  4HIZ A;  2X3U A;  1NBM A;  3JQP A;  2Q6K A;  1KD1 D;  4RPD A;  5KSW B;  4ZCL A;  1UMK A;  5F4J A;  1W9X A;  1F20 A;  2E1R A;  1WSR A;  1ZUN B;  2DCU A;  1GVH A;  4LBZ A;  3W2G A;  4M0L A;  1P4M A;  1WOS A;  2CBX A;  1T6X A;  1JNY A;  1QVF B;  3A3G A;  3CES A;  3V76 A;  3ONY A;  3ZUG A;  3CCR B;  3BY2 A;  4ZV4 A;  1N05 A;  2VZL A;  1QG0 A;  2XND A;  2ZL6 A;  2BN4 A;  1V0F A;  3WND A;  1YLO A;  2OYN A;  1E62 A;  2JN9 A;  1MRZ A;  3CB4 A;  1QVG B;  4WZT A;  1UD3 A;  1W35 A;  4YAU A;  3QFT A;  1CNE A;  4WZL A;  3QFS A;  3BY1 A;  4ACA A;  1KK1 A;  1OB5 A;  1A8P A;  4Z4T A;  3AVW A;  3CME B;  3A35 A;  1TLL A;  5DN6 A;  4X7F A;  5BSY A;  1WU8 A;  1IHM A;  4PC3 A;  1WDT A;  3T56 B;  4P12 A;  5FNZ A;  3JU4 A;  1KC8 D;  3CXC B;  1WP6 A;  3SJZ A;  5TR9 A;  3KL9 A;  2GJP A;  2CW5 A;  3BQJ A;  4YAW A;  3CC7 B;  1DDI A;  2DY1 A;  4X05 A;  5FO0 A;  1WTH D;  3WBK A;  4ZCM A;  2KVO A;  3WBJ A;  2DYI A;  1WPC A;  1WOR A;  4RJL A;  4NNJ A;  1M1K D;  4AC9 A;  3H9N A;  3A3B A;  1T6Z A;  2PLF A;  3Q3A A;  4Z4R A;  3BH4 A;  3BC9 A;  1I18 A;  2BM1 A;  3I1F A;  3ZIA A;  1FND A;  1SKY B;  2C5H A;  4E0F A;  4XL9 A;  3ZZ0 A;  1JJ2 B;  4TT3 A;  5GV8 A;  2ZZE A;  2B7C A;  4G7X A;  4XN3 A;  1AIP A;  3OKX A;  1UD2 A;  3VMF A;  3WY9 A;  2M5S A;  2YWF A;  4XR6 A;  3I56 B;  2X53 S;  4PAA A;  1T6Y A;  3GQB A;  3CPW B;  5F4O A;  4YXW A;  4UZF A;  1K8A D;  1E63 A;  3QFC A;  4WQM A;  2GK7 A;  2VBU A;  2PE3 A;  4OOX A;  4QV2 A;  4X8I A;  3CP2 A;  4RDL A;  3OE7 A;  1NDH A;  1QX4 A;  2OTJ B;  1HVX A;  4B47 A;  1XE1 A;  4B48 A;  1IB0 A;  1VQK B;  4P26 A;  4OPV A;  4YAO A;  3WXM A;  2DIE A;  2HMA A;  3KEW A;  1OB2 A;  2VBS A;  1PJ5 A;  4PAB A;  4KKU A;  1N0U A;  5TY0 A;  4AF6 A;  4GQN A;  3AVT A;  3MCA A;  5A88 A;  4XNF A;  1QGY A;  5FA6 A;  2GQF A;  3CCM B;  4PGO A;  1CNF A;  2XOK A;  2F4N A;  2JJ1 A;  2OBS A;  4QUZ A;  1B23 P;  3AVV A;  3OW7 A;  1GR1 A;  2LZJ A;  4XLC A;  4C0S A;  3OEE A;  4LC0 A;  5BSX A;  2X0K A;  3U6K A;  2VYQ A;  4XM3 A;  1VQM B;  1QFY A;  3E1Y E;  4N3N A;  2CK3 A;  3FPK A;  1VF7 A;  4P6V F;  4EH1 A;  1YJ9 B;  3CMA B;  2ZIT A;  2XZP A;  2WJV A;  4LBY A;  4OP7 A;  4G6I A;  1FX0 A;  1EWY A;  1FRN A;  3GSI A;  4XN0 A;  4PC1 A;  1VQ6 B;  3CPX A;  2QE7 A;  5TV2 A;  2YWH A;  2V31 A;  4FN5 A;  2BVN A;  3AVU A;  1EFC A;  1V0E A;  2GPJ A;  1I7P A;  4XMY A;  3RY8 A;  4P25 A;  2HCJ B;  3DDY A;  1ZM3 A;  5GV7 A;  1K28 D;  1D8T A;  2XGJ A;  1UD6 A;  4KKS A;  1IJE A;  2C77 A;  4F7D A;  3G71 B;  3I55 B;  1EP2 B;  1BJK A;  2D3N A;  3MMP A;  5A8A A;  1UD8 A;  1OHH A;  2DOG A;  2VNI A;  4P6Y A;  2ZXH A;  2X6X A;  4DNT B;  2Q6L A;  3OFN A;  2V7T A;  1Q9S A;  1W0J A;  4UZE A;  3OZU A;  4Z1M A;  4R71 A;  3Q6Q A;  2OK7 A;  4AF7 A;  1WOP A;  2BSA A;  3HAG A;  1R5B A;  3SJP A;  2R6H A;  1ZM4 A;  4FK8 A;  5HZB A;  3NE5 B;  2D9R A;  2V7V A;  1EFR A;  1GAQ A;  1N0V C;  2V7Q A;  1K73 D;  2C2W A;  1NRK A;  5IYW A;  1GAW A;  1PKV A;  1AMO A;  5HKK A;  2HLD A;  1NB9 A;  1GJR A;  4B44 A;  3AVY A;  2VBT A;  2VJJ A;  3BCD A;  4B3F X;  3ASR A;  1U2R A;  4RDJ A;  1EFT A;  2C4T A;  4Y9R A;  1Q82 D;  1EFU A;  1E3Z A;  1E3X A;  4RCZ A;  1ZM2 A;  1E64 A;  1D2E A;  1T5E A;  3PA2 A;  1G7T A;  3JQQ A;  3AGP A;  3AST A;  4HE6 A;  5FO1 A;  2NPF A;  4TSF A;  3VNV A;  1VQO B;  4Z4V A;  4G7W A;  2ZZQ A;  2E1B A;  4B3G A;  4P3I A;  5IK2 A;  4ASU A;  4G1B A;  2B7B A;  2EIX A;  3WNC A;  1FNM A;  3CCJ B;  1Q81 D;  3SKB A;  4RM0 A;  1G7S A;  1QUE A;  1W87 A;  3A1P A;  4P22 A;  3J81 k;  2X8K A;  2V7W A;  2VNJ A;  2QTL A;  1KZL A;  2CC2 A;  4Q7J B;  1VQ7 B;  1VLY A;  2ZTN A;  3CCL B;  4ZGN B;  1JB9 A;  2VJI A;  2AHO A;  3U2Q A;  4DQL A;  1S72 B;  1DG1 G;  2JDI A;  3GVL A;  3CC4 B;  3JQR A;  4II2 A;  3ZPN A;  3Q39 A;  2BPO A;  1R5N A;  3A8K A; 
#chains in the Genus database with same CATH homology
 2D9R A;  2NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...