2D9RA

Structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83]
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08922 DUF1905 Domain of unknown function (DUF1905)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.100 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 AF2212/PG0164-like 2d9rA00
2D9RA
chains in the Genus database with same CATH superfamily
1UD3A 2DIEA 3A8JA 2JJ1A 4X0CA 1DDGA 2ZBVA 2OYNA 4Z4SA 4P9SA 2CK3A 3AGQA 3I1FA 1H8EA 2OTLB 4Z4UA 1VLOA 3CB4A 2W6IA 2RC5A 2QMUA 4B43A 3CPWB 3A3BA 4QVAA 2YWHA 2ZXHA 3WBKA 2D3LA 3V76A 1SKYB 3CRZA 3QE2A 2V31A 4DK1A 2D3NA 3MHPA 4U9UA 5F4MA 4MYUA 3VNVA 2XNCA 2QDXA 3FPPA 4YAUA 4M4SA 4PGOA 1NRKA 1G7CA 1JA0A 3AGPA 4G7XA 4RDJA 3H94A 4RD0A 1EP1B 3VMFA 4B3GA 2DEUA 2R6HA 1YLOA 1N0VC 2OK8A 1H8HA 2D74A 4Z4VA 4DQKA 2X6WA 2X6XA 3OW7A 2E1RA 1TLLA 3VO2A 4Y9UA 4LBYA 2C2WA 4XLAA 1GVHA 3BCDA 2C5BA 4FXUA 4FN5A 3Q6RA 4J0QA 1WOSA 4LBVA 1N05A 3RY8A 1IJFA 3BH4A 3OJWA 4CQJA 2BM0A 2BV3A 2XZOA 1AIPA 2V7UA 3KL9A 3Q6QA 4QUZA 2P3MA 4P6VF 1K9MD 4P1VA 4OPOA 2LZJA 2DYIA 4XM3A 4XQFA 1EP3B 1G7TA 1TTTA 4G7WA 4BPRA 3PUNA 2VNIA 3ZIAA 1VQNB 4RD4A 1KQSB 4PC3A 1COWA 2ZBUA 4ZGQB 5LMZA 3CC7B 1W2BB 1VHOA 3U6BA 2VJJA 1GO2A 2EFGA 1IB0A 1OGIA 1T5EA 3B78A 4XMYA 2F4NA 4FK8A 4UZEA 1GJRA 1W0KA 2HLDA 3WNCA 2C4UA 4YEJA 1ELOA 2WZPP 5IYWA 2VBUA 5A88A 5KNLA 3E1YE 5TRDA 3AVYA 2VBSA 4ZGNB 1NB9A 1NDHA 4IW3B 4ASUA 2DETA 3J81k 3ASPA 5KSWB 1FRQA 1M90D 3R6JA 4RD1A 1DARA 2YWFA 3CP2A 1E79A 2ZITA 1R5OA 3DDYA 1E43A 4XKVA 4AF6A 5J35A 2V4DA 4XKWA 2BM1A 1KTVA 1ZM3A 2QN6A 3PVDA 1WDTA 5TY0A 1WPCA 4P22A 2CW5A 3PUMA 2OBTA 4RCZA 4H9GA 3E20A 1Q86D 2ZL5A 2FVGA 1GAQA 1PJ7A 1KRHA 1PJ5A 5IYNA 4P25A 3PENA 3SKBA 4ACBA 3A8IA 1BMFA 4RJLA 3CCQB 3MCAA 4NCNA 3AVWA 1TUIA 4YELA 4N3NA 1UD8A 3JQPA 5A89A 3CPXA 2BMWA 3OEHA 1FNMA 1FDRA 4RCYA 5IYRA 2JDIA 3AVTA 2BSAA 2XZPA 3I56B 3GSIA 4X05A 2D9RA 1UD2A 5FO0A 1OB5A 1P4MA 1Y0YA 3HAGA 3W5UA 2GQFA 1KD1D 2CC2A 1PJ6A 3VNUA 5DN6A 3G71B 3CCSB 3CW2A 2PIAA 4X7FA 4RD3A 4ZCIA 1F20A 2B5OA 4G1VA 4TSFA 4UAJA 5THXA 3CCVB 4Z4WA 2BN4A 3FPKA 3LQ6A 4F7DA 1VQ5B 4B47A 4X06A 1YIJB 5L46A 1N06A 4XNFA 4OOXA 5TR9A 4UZUA 4Z4YA 4OP7A 1EXMA 1VQLB 3SEJA 2WPDA 4OPSA 4RD2A 3ONYA 4P12A 5FL7A 5B6IA 1YJ9B 3BY2A 2QTLA 3OOCA 3A8KA 4AF7A 1N8RD 3ES9A 3H9NA 2W6JA 4X7DA 1HZEA 4Y9RA 1E1RA 1QVGB 1S72B 5GV8A 1QGYA 3CC4B 1OB2A 4JMQA 1QUFA 3OEEA 3BC9A 4PABA 2E1BA 3CESA 2BPOA 1OB0A 2ZXIA 3OJXA 4X7EA 2DOGA 4B48A 1GAWA 4QV2A 1UD4A 3QSYA 3QFTA 4OOVA 2GREA 1CNFA 3V7AA 1FNDA 3BCFA 3A35A 5HKKA 4WZKA 1T6YA 4II3A 2X3UA 4TKOB 2JIZA 1QX4A 1A8PA 4ZCLA 1R5BA 3CMMA 4ACAA 1Q7YD 1IJEA 4NBSA 2ZTGA 2PLFA 2GPJA 2XZLA 3W2FA 1QFYA 4XN0A 4TMVA 1KC8D 3BQJA 3OZWA 5DS0A 4Z4RA 4M0LA 1W87A 3PA2A 4KKTA 2ZZFA 2VJIA 1UD6A 2VBTA 1WP6A 2VNKA 1RQRA 3OZVA 1T6ZA 4N3GA 3W5VA 4RDKA 5EMNA 3SLDA 2WJVA 4TMWA 5BSXA 5FNZA 3GIRA 1E63A 1WSVA 1Q82D 4LBWA 3KEWA 4Z4ZA 1EFRA 2KVOA 4XLEA 5HXBA 4AVZA 1AMOA 1W9XA 1VQ9B 1W35A 4XLCA 3SJPA 4TN1A 1V5VA 4UZFA 3GVLA 1EWYA 4P26A 2YWGA 2RC6A 3CP8A 4II2A 3CCJB 5A8AA 2ZZEA 3GVJA 3CMAB 1BPLA 2OBRA 2JJ2A 2CRVA 4YAWA 1S4MA 1XFOA 4PC1A 2F1LA 1CNEA 2QEXB 4L8JA 3CTAA 1VJSA 2NV4A 4HE5A 5DSZA 1FX0A 4Z1MA 3LO8A 2R9VA 3ZC3A 3WBJA 3FJOA 2X8KA 1VQ4B 2CF4A 2WJYA 2GJPA 4TT3A 1WU8A 5IYPA 2GK6A 3CD6B 4QVJA 2B7BA 1VHEA 4WWVA 1JJ2B 1G7RA 3G4SB 3T53B 4XD7A 4G6IA 3CCUB 2QGGA 2XOKA 5HZBA 3OPOA 1SM4A 3OZUA 4WZTA 4XLFA 1JB9A 1K73D 3OE7A 2XNDA 4QFMA 4G1BA 5E6TA 3WXMA 2EIXA 3CCMB 3ISXA 3Q38A 4RM0A 2V7XA 3OFNA 1QG0A 2WSSA 2PE3A 1KK1A 1I8DA 2WZNA 1ZM4A 3BNWA 4MYTA 4NNJA 4YAFA 4DNTB 3G05A 3WYAA 5IYQA 1Q81D 3I55B 5F4JA 2Q6IA 2VYQA 3MMPA 4TMTA 2ZTNA 4P2NA 1NBMA 3B8HA 1ZM2A 2V7QA 1S0UA 4C43A 4GQNA 3JQQA 2GJRA 3AVUA 4HE6A 2C77A 1E1QA 1DDIA 2QE7A 4X7CA 5H59A 2HMAA 2QTZA 4YAOA 1FNCA 1NB0A 3CXCB 2GJKA 2OTJB 2VZLA 3QFSA 4FWTA 4RPDA 5IK2A 3QFRA 1QFJA 1WORA 4WZEA 1QFZA 3BY1A 4TMXA 1V0EA 4M2LA 4EH1A 3OP1A 1YHQB 1BX0A 3T56B 4YXWA 5FIUA 1EP2B 2BF4A 4Z4TA 1OGJA 1VQ7B 1F60A 1WTHD 4B4DA 4QHYA 1Q9SA 1YJNB 1FRNA 5KW9A 3ZBUA 1T6XA 2C78A 2V7VA 2DCUA 1KK3A 1QH0A 3A3GA 4G5GA 4K1XA 3LNNA 1E3XA 1W0JA 2WYRA 5GV7A 5FA6A 1N0UA 1BJKA 1ZUNB 2B7CA 4XONA 3U6KA 1VQKB 1VQOB 1RQPA 4R71A 1CQXA 1VLYA 2M5SA 4OOSA 1EFCA 1NJID 3ASQA 3W2HA 1WSRA 4XN3A 2AHOA 4PC7A 1HA3A 2DY1A 2FX3A 1E64A 3ONUA 1H42A 4KKSA 3ZZTA 1I18A 3LVBA 1WOPA 1K28D 3WNDA 2CBXA 3LQEA 2X85A 2Z6BD 1N08A 1EFTA 4DNRB 1B2RA 3CMEB 4P3IA 3JU4A 3VR6A 2HDNB 2JN9A 3OW2B 2J7KA 1UD5A 3ZBTA 1D1NA 3ZZUA 3U2QA 1YX2A 3NE5B 3W5HA 1BX1A 3Q3AA 3VO1A 3WNBA 2VBVA 2DERA 4AC9A 5TV2A 1XE1A 1OHHA 4C0SA 1YJWB 5CDFA 1E62A 4B3XA 2GK7A 1SKQA 3PA1A 3OAAA 3ASSA 1KK0A 2OK7A 2HCJB 2XGJA 4Q7JB 1WOOA 2NPFA 1I7PA 2YWEA 1KJZA 5AN9A 2XNJA 2QA4B 1QUEA 1E3ZA 3AVVA 1FNBA 4XOPA 1XB2A 1KK2A 3R6KA 3A1PA 4XLHA 1V0FA 2BVNA 1DG1G 2PMDA 3CCEB 2F43A 3ASTA 4OPVA 4YALA 1IHMA 1U2RA 4LC0A 4XR6A 2ZZQA 3GQBA 1JA1A 3AVXA 2CNDA 2Q6KA 4PAAA 3CC2B 3CCLB 1GR1A 3P27A 3W2EA 1KZLA 1G7SA 3P26A 2WR8A 2X53S 3WQZA 2ZL6A 4B3FX 1KMHA 4P3YA 3T51B 5F4OA 4P6YA 1JNYA 4XL9A 2BGJA 3B82A 4DK0A 4ZCMA 5HZAA 3D26A 1TVCA 3SJZA 4HIZA 2V7WA 3ZPNA 4M1KA 4X8IA 4E0FA 1ZM9A 4PC2A 4KKUA 4LBZA 1J9ZA 1UMKA 1MRZA 2Q6OA 2VNJA 5H5JA 3W2GA 2C4TA 3GVKA 1BQEA 2VNHA 2XEXA 1R5NA 1B23P 2X6YA 2C5HA 3FKSA 4XOTA 3ASRA 5JBQA 1QGZA 4X07A 2Q6LA 4M53A 4PC6A 5J3OA 1Y0RA 1EFUA 1VQMB 3OKXA 1VQ8B 4DQLA 1K8AD 1M1KD 4WQMA 1XQBA 2BGIA 4WZLA 4ZV4A 3G6EB 1W34A 2ZZGA 1QVFB 1D2EA 3CCRB 1D8TA 2OBSA 3ZUGA 1YI2B 4YHBA 2X0KA 1VQPB 2F1MA 2I1LA 3JQRA 1N07A 4RLZA 1VQ6B 1BLIA 1HVXA 2ZL7A 3SLNA 4B44A 1MABA 4RDLA 3Q39A 4TMZA 1QGAA 1VF7A 3QFCA 4ROXA 2V7TA 4RPBA 3ZZ0A 1PKVA 4RD6A 4XORA 4Y7CA 5BSYA 3WY9A 3W2IA 1H85A 1YITB 5FO1A
chains in the Genus database with same CATH topology
2NWTA 2D9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9R A; 
#chains in the Genus database with same CATH topology
 1UD3 A;  2DIE A;  3A8J A;  2JJ1 A;  4X0C A;  1DDG A;  2ZBV A;  2OYN A;  4Z4S A;  4P9S A;  2CK3 A;  3AGQ A;  3I1F A;  1H8E A;  2OTL B;  4Z4U A;  1VLO A;  3CB4 A;  2W6I A;  2RC5 A;  2QMU A;  4B43 A;  3CPW B;  3A3B A;  4QVA A;  2YWH A;  2ZXH A;  3WBK A;  2D3L A;  3V76 A;  1SKY B;  3CRZ A;  3QE2 A;  2V31 A;  4DK1 A;  2D3N A;  3MHP A;  4U9U A;  5F4M A;  4MYU A;  3VNV A;  2XNC A;  2QDX A;  3FPP A;  4YAU A;  4M4S A;  4PGO A;  1NRK A;  1G7C A;  1JA0 A;  3AGP A;  4G7X A;  4RDJ A;  3H94 A;  4RD0 A;  1EP1 B;  3VMF A;  4B3G A;  2DEU A;  2R6H A;  1YLO A;  1N0V C;  2OK8 A;  1H8H A;  2D74 A;  4Z4V A;  4DQK A;  2X6W A;  2X6X A;  3OW7 A;  2E1R A;  1TLL A;  3VO2 A;  4Y9U A;  4LBY A;  2C2W A;  4XLA A;  1GVH A;  3BCD A;  2C5B A;  4FXU A;  4FN5 A;  3Q6R A;  4J0Q A;  1WOS A;  4LBV A;  1N05 A;  3RY8 A;  1IJF A;  3BH4 A;  3OJW A;  4CQJ A;  2BM0 A;  2BV3 A;  2XZO A;  1AIP A;  2V7U A;  3KL9 A;  3Q6Q A;  4QUZ A;  2P3M A;  4P6V F;  1K9M D;  4P1V A;  4OPO A;  2LZJ A;  2DYI A;  4XM3 A;  4XQF A;  1EP3 B;  1G7T A;  1TTT A;  4G7W A;  4BPR A;  3PUN A;  2VNI A;  3ZIA A;  1VQN B;  4RD4 A;  1KQS B;  4PC3 A;  1COW A;  2ZBU A;  4ZGQ B;  5LMZ A;  3CC7 B;  1W2B B;  1VHO A;  3U6B A;  2VJJ A;  1GO2 A;  2EFG A;  1IB0 A;  1OGI A;  1T5E A;  3B78 A;  4XMY A;  2F4N A;  4FK8 A;  4UZE A;  1GJR A;  1W0K A;  2HLD A;  3WNC A;  2C4U A;  4YEJ A;  1ELO A;  2WZP P;  5IYW A;  2VBU A;  5A88 A;  5KNL A;  3E1Y E;  5TRD A;  3AVY A;  2VBS A;  4ZGN B;  1NB9 A;  1NDH A;  4IW3 B;  4ASU A;  2DET A;  3J81 k;  3ASP A;  5KSW B;  1FRQ A;  1M90 D;  3R6J A;  4RD1 A;  1DAR A;  2YWF A;  3CP2 A;  1E79 A;  2ZIT A;  1R5O A;  3DDY A;  1E43 A;  4XKV A;  4AF6 A;  5J35 A;  2V4D A;  4XKW A;  2BM1 A;  1KTV A;  1ZM3 A;  2QN6 A;  3PVD A;  1WDT A;  5TY0 A;  1WPC A;  4P22 A;  2CW5 A;  3PUM A;  2OBT A;  4RCZ A;  4H9G A;  3E20 A;  1Q86 D;  2ZL5 A;  2FVG A;  1GAQ A;  1PJ7 A;  1KRH A;  1PJ5 A;  5IYN A;  4P25 A;  3PEN A;  3SKB A;  4ACB A;  3A8I A;  1BMF A;  4RJL A;  3CCQ B;  3MCA A;  4NCN A;  3AVW A;  1TUI A;  4YEL A;  4N3N A;  1UD8 A;  3JQP A;  5A89 A;  3CPX A;  2BMW A;  3OEH A;  1FNM A;  1FDR A;  4RCY A;  5IYR A;  2JDI A;  3AVT A;  2BSA A;  2XZP A;  3I56 B;  3GSI A;  4X05 A;  2D9R A;  1UD2 A;  5FO0 A;  1OB5 A;  1P4M A;  1Y0Y A;  3HAG A;  3W5U A;  2GQF A;  1KD1 D;  2CC2 A;  1PJ6 A;  3VNU A;  5DN6 A;  3G71 B;  3CCS B;  3CW2 A;  2PIA A;  4X7F A;  4RD3 A;  4ZCI A;  1F20 A;  2B5O A;  4G1V A;  4TSF A;  4UAJ A;  5THX A;  3CCV B;  4Z4W A;  2BN4 A;  3FPK A;  3LQ6 A;  4F7D A;  1VQ5 B;  4B47 A;  4X06 A;  1YIJ B;  5L46 A;  1N06 A;  4XNF A;  4OOX A;  5TR9 A;  4UZU A;  4Z4Y A;  4OP7 A;  1EXM A;  1VQL B;  3SEJ A;  2WPD A;  4OPS A;  4RD2 A;  3ONY A;  4P12 A;  5FL7 A;  5B6I A;  1YJ9 B;  3BY2 A;  2QTL A;  3OOC A;  3A8K A;  4AF7 A;  1N8R D;  3ES9 A;  3H9N A;  2W6J A;  4X7D A;  1HZE A;  4Y9R A;  1E1R A;  1QVG B;  1S72 B;  5GV8 A;  1QGY A;  3CC4 B;  1OB2 A;  4JMQ A;  1QUF A;  3OEE A;  3BC9 A;  4PAB A;  2E1B A;  3CES A;  2BPO A;  1OB0 A;  2ZXI A;  3OJX A;  4X7E A;  2DOG A;  4B48 A;  1GAW A;  4QV2 A;  1UD4 A;  3QSY A;  3QFT A;  4OOV A;  2GRE A;  1CNF A;  3V7A A;  1FND A;  3BCF A;  3A35 A;  5HKK A;  4WZK A;  1T6Y A;  4II3 A;  2X3U A;  4TKO B;  2JIZ A;  1QX4 A;  1A8P A;  4ZCL A;  1R5B A;  3CMM A;  4ACA A;  1Q7Y D;  1IJE A;  4NBS A;  2ZTG A;  2PLF A;  2GPJ A;  2XZL A;  3W2F A;  1QFY A;  4XN0 A;  4TMV A;  1KC8 D;  3BQJ A;  3OZW A;  5DS0 A;  4Z4R A;  4M0L A;  1W87 A;  3PA2 A;  4KKT A;  2ZZF A;  2VJI A;  1UD6 A;  2VBT A;  1WP6 A;  2VNK A;  1RQR A;  3OZV A;  1T6Z A;  4N3G A;  3W5V A;  4RDK A;  5EMN A;  3SLD A;  2WJV A;  4TMW A;  5BSX A;  5FNZ A;  3GIR A;  1E63 A;  1WSV A;  1Q82 D;  4LBW A;  3KEW A;  4Z4Z A;  1EFR A;  2KVO A;  4XLE A;  5HXB A;  4AVZ A;  1AMO A;  1W9X A;  1VQ9 B;  1W35 A;  4XLC A;  3SJP A;  4TN1 A;  1V5V A;  4UZF A;  3GVL A;  1EWY A;  4P26 A;  2YWG A;  2RC6 A;  3CP8 A;  4II2 A;  3CCJ B;  5A8A A;  2ZZE A;  3GVJ A;  3CMA B;  1BPL A;  2OBR A;  2JJ2 A;  2CRV A;  4YAW A;  1S4M A;  1XFO A;  4PC1 A;  2F1L A;  1CNE A;  2QEX B;  4L8J A;  3CTA A;  1VJS A;  2NV4 A;  4HE5 A;  5DSZ A;  1FX0 A;  4Z1M A;  3LO8 A;  2R9V A;  3ZC3 A;  3WBJ A;  3FJO A;  2X8K A;  1VQ4 B;  2CF4 A;  2WJY A;  2GJP A;  4TT3 A;  1WU8 A;  5IYP A;  2GK6 A;  3CD6 B;  4QVJ A;  2B7B A;  1VHE A;  4WWV A;  1JJ2 B;  1G7R A;  3G4S B;  3T53 B;  4XD7 A;  4G6I A;  3CCU B;  2QGG A;  2XOK A;  5HZB A;  3OPO A;  1SM4 A;  3OZU A;  4WZT A;  4XLF A;  1JB9 A;  1K73 D;  3OE7 A;  2XND A;  4QFM A;  4G1B A;  5E6T A;  3WXM A;  2EIX A;  3CCM B;  3ISX A;  3Q38 A;  4RM0 A;  2V7X A;  3OFN A;  1QG0 A;  2WSS A;  2PE3 A;  1KK1 A;  1I8D A;  2WZN A;  1ZM4 A;  3BNW A;  4MYT A;  4NNJ A;  4YAF A;  4DNT B;  3G05 A;  3WYA A;  5IYQ A;  1Q81 D;  3I55 B;  5F4J A;  2Q6I A;  2VYQ A;  3MMP A;  4TMT A;  2ZTN A;  4P2N A;  1NBM A;  3B8H A;  1ZM2 A;  2V7Q A;  1S0U A;  4C43 A;  4GQN A;  3JQQ A;  2GJR A;  3AVU A;  4HE6 A;  2C77 A;  1E1Q A;  1DDI A;  2QE7 A;  4X7C A;  5H59 A;  2HMA A;  2QTZ A;  4YAO A;  1FNC A;  1NB0 A;  3CXC B;  2GJK A;  2OTJ B;  2VZL A;  3QFS A;  4FWT A;  4RPD A;  5IK2 A;  3QFR A;  1QFJ A;  1WOR A;  4WZE A;  1QFZ A;  3BY1 A;  4TMX A;  1V0E A;  4M2L A;  4EH1 A;  3OP1 A;  1YHQ B;  1BX0 A;  3T56 B;  4YXW A;  5FIU A;  1EP2 B;  2BF4 A;  4Z4T A;  1OGJ A;  1VQ7 B;  1F60 A;  1WTH D;  4B4D A;  4QHY A;  1Q9S A;  1YJN B;  1FRN A;  5KW9 A;  3ZBU A;  1T6X A;  2C78 A;  2V7V A;  2DCU A;  1KK3 A;  1QH0 A;  3A3G A;  4G5G A;  4K1X A;  3LNN A;  1E3X A;  1W0J A;  2WYR A;  5GV7 A;  5FA6 A;  1N0U A;  1BJK A;  1ZUN B;  2B7C A;  4XON A;  3U6K A;  1VQK B;  1VQO B;  1RQP A;  4R71 A;  1CQX A;  1VLY A;  2M5S A;  4OOS A;  1EFC A;  1NJI D;  3ASQ A;  3W2H A;  1WSR A;  4XN3 A;  2AHO A;  4PC7 A;  1HA3 A;  2DY1 A;  2FX3 A;  1E64 A;  3ONU A;  1H42 A;  4KKS A;  3ZZT A;  1I18 A;  3LVB A;  1WOP A;  1K28 D;  3WND A;  2CBX A;  3LQE A;  2X85 A;  2Z6B D;  1N08 A;  1EFT A;  4DNR B;  1B2R A;  3CME B;  4P3I A;  3JU4 A;  3VR6 A;  2HDN B;  2JN9 A;  3OW2 B;  2J7K A;  1UD5 A;  3ZBT A;  1D1N A;  3ZZU A;  3U2Q A;  1YX2 A;  3NE5 B;  3W5H A;  1BX1 A;  3Q3A A;  3VO1 A;  3WNB A;  2VBV A;  2DER A;  4AC9 A;  5TV2 A;  1XE1 A;  1OHH A;  4C0S A;  1YJW B;  5CDF A;  1E62 A;  4B3X A;  2GK7 A;  1SKQ A;  3PA1 A;  3OAA A;  3ASS A;  1KK0 A;  2OK7 A;  2HCJ B;  2XGJ A;  4Q7J B;  1WOO A;  2NPF A;  1I7P A;  2YWE A;  1KJZ A;  5AN9 A;  2XNJ A;  2QA4 B;  1QUE A;  1E3Z A;  3AVV A;  1FNB A;  4XOP A;  1XB2 A;  1KK2 A;  3R6K A;  3A1P A;  4XLH A;  1V0F A;  2BVN A;  1DG1 G;  2PMD A;  3CCE B;  2F43 A;  3AST A;  4OPV A;  4YAL A;  1IHM A;  1U2R A;  4LC0 A;  4XR6 A;  2ZZQ A;  3GQB A;  1JA1 A;  3AVX A;  2CND A;  2Q6K A;  4PAA A;  3CC2 B;  3CCL B;  1GR1 A;  3P27 A;  3W2E A;  1KZL A;  1G7S A;  3P26 A;  2WR8 A;  2X53 S;  3WQZ A;  2ZL6 A;  4B3F X;  1KMH A;  4P3Y A;  3T51 B;  5F4O A;  4P6Y A;  1JNY A;  4XL9 A;  2BGJ A;  3B82 A;  4DK0 A;  4ZCM A;  5HZA A;  3D26 A;  1TVC A;  3SJZ A;  4HIZ A;  2V7W A;  3ZPN A;  4M1K A;  4X8I A;  4E0F A;  1ZM9 A;  4PC2 A;  4KKU A;  4LBZ A;  1J9Z A;  1UMK A;  1MRZ A;  2Q6O A;  2VNJ A;  5H5J A;  3W2G A;  2C4T A;  3GVK A;  1BQE A;  2VNH A;  2XEX A;  1R5N A;  1B23 P;  2X6Y A;  2C5H A;  3FKS A;  4XOT A;  3ASR A;  5JBQ A;  1QGZ A;  4X07 A;  2Q6L A;  4M53 A;  4PC6 A;  5J3O A;  1Y0R A;  1EFU A;  1VQM B;  3OKX A;  1VQ8 B;  4DQL A;  1K8A D;  1M1K D;  4WQM A;  1XQB A;  2BGI A;  4WZL A;  4ZV4 A;  3G6E B;  1W34 A;  2ZZG A;  1QVF B;  1D2E A;  3CCR B;  1D8T A;  2OBS A;  3ZUG A;  1YI2 B;  4YHB A;  2X0K A;  1VQP B;  2F1M A;  2I1L A;  3JQR A;  1N07 A;  4RLZ A;  1VQ6 B;  1BLI A;  1HVX A;  2ZL7 A;  3SLN A;  4B44 A;  1MAB A;  4RDL A;  3Q39 A;  4TMZ A;  1QGA A;  1VF7 A;  3QFC A;  4ROX A;  2V7T A;  4RPB A;  3ZZ0 A;  1PKV A;  4RD6 A;  4XOR A;  4Y7C A;  5BSY A;  3WY9 A;  3W2I A;  1H85 A;  1YIT B;  5FO1 A; 
#chains in the Genus database with same CATH homology
 2NWT A;  2D9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...