The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
127
|
structure length |
127
|
Chain Sequence |
SEVPLFDINALGDWTYLGTSLPAKFAKLFASILHCIDDEYFLITPVEKVRVQVEDAPLLIVDFERAQPHSLLNVSTSIGTLHHNVDIKQMKLTDDSVYLPLERGLWGKLGRACYYNFVNEFNLSDLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction.
pubmed doi rcsb |
| molecule tags |
Unknown function
|
| source organism |
Shewanella baltica
|
| molecule keywords |
Uncharacterized protein DUF1285
|
| total genus |
28
|
| structure length |
127
|
| sequence length |
127
|
| ec nomenclature | |
| pdb deposition date | 2007-09-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06938 | DUF1285 | Protein of unknown function (DUF1285) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | duf1285 protein fold | duf1285 protein | ||
| Alpha Beta | Roll | duf1285 like fold | duf1285 like domain |
#chains in the Genus database with same CATH superfamily 2RE3 A; 2RA9 A; #chains in the Genus database with same CATH topology 1W4C A; 1W49 A; 4BLT A; 2VHJ A; 3ILR A; 1YWY A; 1W48 A; 1W46 A; 2VHT A; 1W44 A; 3IN9 A; 2VHQ A; 3IKW A; 2VHU A; 2VHC A; 1W47 A; 4BLS A; 3IMN A; 2RA9 A; 4BLR A; 2RE3 A; 1W4B A; 3INA A; 1W4A A; #chains in the Genus database with same CATH homology 2RE3 A; 2RA9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
