2RE3A

Crystal structure of a duf1285 family protein (spo_0140) from silicibacter pomeroyi dss-3 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
183
Chain Sequence
SADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIARDGTWFYQGTPINRPAMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAGQGRKQVLTFTTHVGDSAVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLMDLGEIEDGWFGLWSSGSFFPLMTVEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Unknown function
total genus 40
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06938 DUF1285 Protein of unknown function (DUF1285)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2re3A03
2.30.270.10 Mainly Beta Roll duf1285 protein fold duf1285 protein 2re3A02
3.10.540.10 Alpha Beta Roll duf1285 like fold duf1285 like domain 2re3A01
2JX8A 1JMQA 2MDIA 1YW5A 1O6WA 2XP9A 4U86A 3TDBA 3KADA 2ZQTA 1EG4A 2RA9A 2XP7A 2Q5AA 3NTPA 2DK7A 2JXWA 2DMVA 2ZR5A 2YSBA 2XP6A 3KAFA 2ZQVA 3TCZA 1EG3A 2JMFA 3OOBA 3KAIA 3ODKA 3CNGA 2ZAJA 3M7NA 1TK7A 2BA1A 2YSHA 1F8AB 1WR7A 2JV4A 3L4HA 3KABA 3KAHA 1K9QA 2F21A 3KCEA 4U84A 2L4JA 2XP3A 2YSIA 2DJYA 2EZ5W 1PINA 1I5HW 3KAGA 2M3OW 2YSGA 2E45A 2M8IA 2ZR6A 5AHTA 4REXA 2XP4A 3WH0A 1NMVA 2XP8A 2ZQUA 3M85A 2DWVA 2DK1A 2ZR4A 2LAJA 2YSFA 1WMVA 1K9RA 3LE4A 3TC5A 2KXQA 2M8JA 2ZQSA 2RE3A 4U85A 2XPAA 2ITKA 4QIBA 5CQ2A 2XPBA 4E5RA 2XP5A 1ZCNA
chains in the Genus database with same CATH superfamily
1W47A 2JX8A 2VHTA 1JMQA 5E64A 2MDIA 2WADA 1YW5A 1O6WA 2XP9A 4U86A 3TDBA 3KADA 2ZQTA 1EG4A 3FSBA 2RA9A 2XP7A 2Q5AA 3FS8A 3NTPA 4GLXA 2DK7A 2JXWA 2DMVA 2VHJA 1FLCA 1W4BA 3ILRA 3LKXA 2OWOA 3INAA 3FSCA 2ZR5A 2YSBA 2XP6A 3KAFA 2ZQVA 3TCZA 1EG3A 2JMFA 4A0UA 3OOBA 1W44A 3KAIA 3ODKA 3CNGA 1W49A 2ZAJA 3M7NA 1TK7A 2BA1A 1RP5A 2YSHA 3LKXB 1W4CA 1F8AB 5E66A 1TR8A 1WR7A 3IKWA 2JV4A 3MCBA 1W46A 3IMNA 3L4HA 3KABA 3KAHA 1K9QA 2F21A 3KCEA 5E65A 4U84A 2L4JA 2VHCA 2Y8NB 1W48A 2XP3A 4BLSA 2YSIA 2DJYA 2EZ5W 3MCBB 2VHUA 1PINA 1I5HW 3KAGA 2M3OW 2YSGA 5E5WA 2E45A 4BLRA 2M8IA 2WAEA 3MQGA 2ZR6A 5AHTA 4REXA 4A0TA 2XP4A 1W4AA 3WH0A 1NMVA 5U47A 2XP8A 2ZQUA 3M85A 2DWVA 2DK1A 2ZR4A 2YAJB 2LAJA 2YSFA 1WMVA 1K9RA 3LE4A 3TC5A 3PQHA 4BLTA 3IN9A 2KXQA 2M8JA 2ZQSA 2RE3A 4U85A 5E62A 2XPAA 2ITKA 3MQHA 4QIBA 5CQ2A 2VHQA 2QRVA 2XPBA 4E5RA 2XP5A 1YWYA 1ZCNA
chains in the Genus database with same CATH topology
2JX8A 1JMQA 5E64A 2MDIA 2WADA 1YW5A 1O6WA 2XP9A 4U86A 3TDBA 3KADA 2ZQTA 1EG4A 3FSBA 2RA9A 2XP7A 2Q5AA 3FS8A 3NTPA 4GLXA 2DK7A 2JXWA 2DMVA 1FLCA 3LKXA 2OWOA 3FSCA 2ZR5A 2YSBA 2XP6A 3KAFA 2ZQVA 3TCZA 1EG3A 2JMFA 4A0UA 3OOBA 3KAIA 3ODKA 3CNGA 2ZAJA 3M7NA 1TK7A 2BA1A 1RP5A 2YSHA 3LKXB 1F8AB 5E66A 1TR8A 1WR7A 2JV4A 3MCBA 3L4HA 3KABA 3KAHA 1K9QA 2F21A 3KCEA 5E65A 4U84A 2L4JA 2Y8NB 2XP3A 2YSIA 2DJYA 2EZ5W 3MCBB 1PINA 1I5HW 3KAGA 2M3OW 2YSGA 5E5WA 2E45A 2M8IA 2WAEA 3MQGA 2ZR6A 5AHTA 4REXA 4A0TA 2XP4A 3WH0A 1NMVA 5U47A 2XP8A 2ZQUA 3M85A 2DWVA 2DK1A 2ZR4A 2YAJB 2LAJA 2YSFA 1WMVA 1K9RA 3LE4A 3TC5A 3PQHA 2KXQA 2M8JA 2ZQSA 2RE3A 4U85A 5E62A 2XPAA 2ITKA 3MQHA 4QIBA 5CQ2A 2QRVA 2XPBA 4E5RA 2XP5A 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JX8 A;  1JMQ A;  2MDI A;  1YW5 A;  1O6W A;  2XP9 A;  4U86 A;  3TDB A;  3KAD A;  2ZQT A;  1EG4 A;  2RA9 A;  2XP7 A;  2Q5A A;  3NTP A;  2DK7 A;  2JXW A;  2DMV A;  2ZR5 A;  2YSB A;  2XP6 A;  3KAF A;  2ZQV A;  3TCZ A;  1EG3 A;  2JMF A;  3OOB A;  3KAI A;  3ODK A;  3CNG A;  2ZAJ A;  3M7N A;  1TK7 A;  2BA1 A;  2YSH A;  1F8A B;  1WR7 A;  2JV4 A;  3L4H A;  3KAB A;  3KAH A;  1K9Q A;  2F21 A;  3KCE A;  4U84 A;  2L4J A;  2XP3 A;  2YSI A;  2DJY A;  2EZ5 W;  1PIN A;  1I5H W;  3KAG A;  2M3O W;  2YSG A;  2E45 A;  2M8I A;  2ZR6 A;  5AHT A;  4REX A;  2XP4 A;  3WH0 A;  1NMV A;  2XP8 A;  2ZQU A;  3M85 A;  2DWV A;  2DK1 A;  2ZR4 A;  2LAJ A;  2YSF A;  1WMV A;  1K9R A;  3LE4 A;  3TC5 A;  2KXQ A;  2M8J A;  2ZQS A;  2RE3 A;  4U85 A;  2XPA A;  2ITK A;  4QIB A;  5CQ2 A;  2XPB A;  4E5R A;  2XP5 A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 1W47 A;  2JX8 A;  2VHT A;  1JMQ A;  5E64 A;  2MDI A;  2WAD A;  1YW5 A;  1O6W A;  2XP9 A;  4U86 A;  3TDB A;  3KAD A;  2ZQT A;  1EG4 A;  3FSB A;  2RA9 A;  2XP7 A;  2Q5A A;  3FS8 A;  3NTP A;  4GLX A;  2DK7 A;  2JXW A;  2DMV A;  2VHJ A;  1FLC A;  1W4B A;  3ILR A;  3LKX A;  2OWO A;  3INA A;  3FSC A;  2ZR5 A;  2YSB A;  2XP6 A;  3KAF A;  2ZQV A;  3TCZ A;  1EG3 A;  2JMF A;  4A0U A;  3OOB A;  1W44 A;  3KAI A;  3ODK A;  3CNG A;  1W49 A;  2ZAJ A;  3M7N A;  1TK7 A;  2BA1 A;  1RP5 A;  2YSH A;  3LKX B;  1W4C A;  1F8A B;  5E66 A;  1TR8 A;  1WR7 A;  3IKW A;  2JV4 A;  3MCB A;  1W46 A;  3IMN A;  3L4H A;  3KAB A;  3KAH A;  1K9Q A;  2F21 A;  3KCE A;  5E65 A;  4U84 A;  2L4J A;  2VHC A;  2Y8N B;  1W48 A;  2XP3 A;  4BLS A;  2YSI A;  2DJY A;  2EZ5 W;  3MCB B;  2VHU A;  1PIN A;  1I5H W;  3KAG A;  2M3O W;  2YSG A;  5E5W A;  2E45 A;  4BLR A;  2M8I A;  2WAE A;  3MQG A;  2ZR6 A;  5AHT A;  4REX A;  4A0T A;  2XP4 A;  1W4A A;  3WH0 A;  1NMV A;  5U47 A;  2XP8 A;  2ZQU A;  3M85 A;  2DWV A;  2DK1 A;  2ZR4 A;  2YAJ B;  2LAJ A;  2YSF A;  1WMV A;  1K9R A;  3LE4 A;  3TC5 A;  3PQH A;  4BLT A;  3IN9 A;  2KXQ A;  2M8J A;  2ZQS A;  2RE3 A;  4U85 A;  5E62 A;  2XPA A;  2ITK A;  3MQH A;  4QIB A;  5CQ2 A;  2VHQ A;  2QRV A;  2XPB A;  4E5R A;  2XP5 A;  1YWY A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 2JX8 A;  1JMQ A;  5E64 A;  2MDI A;  2WAD A;  1YW5 A;  1O6W A;  2XP9 A;  4U86 A;  3TDB A;  3KAD A;  2ZQT A;  1EG4 A;  3FSB A;  2RA9 A;  2XP7 A;  2Q5A A;  3FS8 A;  3NTP A;  4GLX A;  2DK7 A;  2JXW A;  2DMV A;  1FLC A;  3LKX A;  2OWO A;  3FSC A;  2ZR5 A;  2YSB A;  2XP6 A;  3KAF A;  2ZQV A;  3TCZ A;  1EG3 A;  2JMF A;  4A0U A;  3OOB A;  3KAI A;  3ODK A;  3CNG A;  2ZAJ A;  3M7N A;  1TK7 A;  2BA1 A;  1RP5 A;  2YSH A;  3LKX B;  1F8A B;  5E66 A;  1TR8 A;  1WR7 A;  2JV4 A;  3MCB A;  3L4H A;  3KAB A;  3KAH A;  1K9Q A;  2F21 A;  3KCE A;  5E65 A;  4U84 A;  2L4J A;  2Y8N B;  2XP3 A;  2YSI A;  2DJY A;  2EZ5 W;  3MCB B;  1PIN A;  1I5H W;  3KAG A;  2M3O W;  2YSG A;  5E5W A;  2E45 A;  2M8I A;  2WAE A;  3MQG A;  2ZR6 A;  5AHT A;  4REX A;  4A0T A;  2XP4 A;  3WH0 A;  1NMV A;  5U47 A;  2XP8 A;  2ZQU A;  3M85 A;  2DWV A;  2DK1 A;  2ZR4 A;  2YAJ B;  2LAJ A;  2YSF A;  1WMV A;  1K9R A;  3LE4 A;  3TC5 A;  3PQH A;  2KXQ A;  2M8J A;  2ZQS A;  2RE3 A;  4U85 A;  5E62 A;  2XPA A;  2ITK A;  3MQH A;  4QIB A;  5CQ2 A;  2QRV A;  2XPB A;  4E5R A;  2XP5 A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...