The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
183
|
structure length |
183
|
Chain Sequence |
SADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIARDGTWFYQGTPINRPAMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAGQGRKQVLTFTTHVGDSAVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLMDLGEIEDGWFGLWSSGSFFPLMTVEELER
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Unknown function
|
| source organism |
Silicibacter pomeroyi dss-3
|
| publication title |
Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction.
pubmed doi rcsb |
| molecule keywords |
Uncharacterized protein
|
| total genus |
40
|
| structure length |
183
|
| sequence length |
183
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-09-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06938 | DUF1285 | Protein of unknown function (DUF1285) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; | ||
| Mainly Beta | Roll | duf1285 protein fold | duf1285 protein | ||
| Alpha Beta | Roll | duf1285 like fold | duf1285 like domain |
#chains in the Genus database with same CATH superfamily 1JMQ A; 1F8A B; 2XP9 A; 2JX8 A; 2YSH A; 2BA1 A; 2RA9 A; 3KAB A; 3LE4 A; 4E5R A; 2M8I A; 4QIB A; 2JMF A; 2XP7 A; 2YSI A; 5CQ2 A; 2XPA A; 2E45 A; 2JV4 A; 2ZR4 A; 2ZQS A; 3ODK A; 3OOB A; 2RE3 A; 4REX A; 3TC5 A; 3KAD A; 2YSF A; 1O6W A; 3L4H A; 2ZAJ A; 4U85 A; 2DJY A; 2ZQV A; 2ZQU A; 3KAF A; 2ZR6 A; 3M7N A; 4U84 A; 1EG4 A; 3KAG A; 2M3O W; 2KXQ A; 3WH0 A; 1WMV A; 3CNG A; 3M85 A; 4U86 A; 1K9R A; 1TK7 A; 1I5H W; 2Q5A A; 3KCE A; 1ZCN A; 2M8J A; 2JXW A; 5AHT A; 3NTP A; 2XP8 A; 2XPB A; 2YSB A; 2XP4 A; 1WR7 A; 3KAI A; 2MDI A; 3TDB A; 2ZR5 A; 3KAH A; 2F21 A; 2YSG A; 2XP6 A; 2XP5 A; 2EZ5 W; 1K9Q A; 2ZQT A; 2DMV A; 1NMV A; 3TCZ A; 2XP3 A; 2LAJ A; 2DK7 A; 1YW5 A; 2ITK A; 1EG3 A; 2DWV A; 1PIN A; 2L4J A; 2DK1 A; #chains in the Genus database with same CATH topology 1JMQ A; 1F8A B; 2XP9 A; 2JX8 A; 2VHT A; 1FLC A; 2YSH A; 2Y8N B; 2BA1 A; 2OWO A; 2RA9 A; 4BLR A; 3KAB A; 3LE4 A; 1W48 A; 3ILR A; 4E5R A; 2M8I A; 4QIB A; 3MCB B; 2QRV A; 2JMF A; 2XP7 A; 3MQG A; 2YSI A; 5CQ2 A; 3IKW A; 2VHU A; 1YWY A; 2XPA A; 2E45 A; 2JV4 A; 2ZR4 A; 2ZQS A; 1W4A A; 3ODK A; 3PQH A; 3OOB A; 1W44 A; 2WAE A; 2RE3 A; 4REX A; 3TC5 A; 3KAD A; 2YSF A; 1O6W A; 3LKX B; 2VHJ A; 1TR8 A; 3MCB A; 3L4H A; 5E5W A; 2ZAJ A; 4U85 A; 2DJY A; 2ZQV A; 2ZQU A; 2VHC A; 3KAF A; 1W46 A; 2ZR6 A; 3M7N A; 4U84 A; 4BLT A; 3IN9 A; 1EG4 A; 3KAG A; 2M3O W; 5E64 A; 2KXQ A; 5E66 A; 3WH0 A; 1WMV A; 3FSB A; 3CNG A; 3M85 A; 1W49 A; 5U47 A; 4U86 A; 2VHQ A; 1K9R A; 1TK7 A; 1I5H W; 2Q5A A; 3KCE A; 1W47 A; 1RP5 A; 1ZCN A; 2M8J A; 3LKX A; 5E65 A; 1W4B A; 2JXW A; 5AHT A; 3NTP A; 2XP8 A; 1W4C A; 2XPB A; 3IMN A; 2YSB A; 4A0U A; 2XP4 A; 1WR7 A; 3FSC A; 3KAI A; 2MDI A; 3TDB A; 2ZR5 A; 3KAH A; 4BLS A; 2F21 A; 2YSG A; 2XP6 A; 2XP5 A; 2EZ5 W; 1K9Q A; 2ZQT A; 2DMV A; 1NMV A; 3TCZ A; 5E62 A; 2XP3 A; 2LAJ A; 3INA A; 2DK7 A; 1YW5 A; 2ITK A; 3FS8 A; 4GLX A; 1EG3 A; 3MQH A; 2DWV A; 2YAJ B; 1PIN A; 2L4J A; 2WAD A; 2DK1 A; 4A0T A; #chains in the Genus database with same CATH homology 1JMQ A; 1F8A B; 2XP9 A; 2JX8 A; 1FLC A; 2YSH A; 2Y8N B; 2BA1 A; 2OWO A; 2RA9 A; 3KAB A; 3LE4 A; 4E5R A; 2M8I A; 4QIB A; 3MCB B; 2QRV A; 2JMF A; 2XP7 A; 3MQG A; 2YSI A; 5CQ2 A; 2XPA A; 2E45 A; 2JV4 A; 2ZR4 A; 2ZQS A; 3ODK A; 3PQH A; 3OOB A; 2WAE A; 2RE3 A; 4REX A; 3TC5 A; 3KAD A; 2YSF A; 1O6W A; 3LKX B; 1TR8 A; 3MCB A; 3L4H A; 5E5W A; 2ZAJ A; 4U85 A; 2DJY A; 2ZQV A; 2ZQU A; 3KAF A; 2ZR6 A; 3M7N A; 4U84 A; 1EG4 A; 3KAG A; 2M3O W; 5E64 A; 2KXQ A; 5E66 A; 3WH0 A; 1WMV A; 3FSB A; 3CNG A; 3M85 A; 5U47 A; 4U86 A; 1K9R A; 1TK7 A; 1I5H W; 2Q5A A; 3KCE A; 1RP5 A; 1ZCN A; 2M8J A; 3LKX A; 5E65 A; 2JXW A; 5AHT A; 3NTP A; 2XP8 A; 2XPB A; 2YSB A; 4A0U A; 2XP4 A; 1WR7 A; 3FSC A; 3KAI A; 2MDI A; 3TDB A; 2ZR5 A; 3KAH A; 2F21 A; 2YSG A; 2XP6 A; 2XP5 A; 2EZ5 W; 1K9Q A; 2ZQT A; 2DMV A; 1NMV A; 3TCZ A; 5E62 A; 2XP3 A; 2LAJ A; 2DK7 A; 1YW5 A; 2ITK A; 3FS8 A; 4GLX A; 1EG3 A; 3MQH A; 2DWV A; 2YAJ B; 1PIN A; 2L4J A; 2WAD A; 2DK1 A; 4A0T A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
