2RE3A

Crystal structure of a duf1285 family protein (spo_0140) from silicibacter pomeroyi dss-3 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
183
Chain Sequence
SADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIARDGTWFYQGTPINRPAMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAGQGRKQVLTFTTHVGDSAVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLMDLGEIEDGWFGLWSSGSFFPLMTVEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
total genus 40
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06938 DUF1285 Protein of unknown function (DUF1285)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2re3A03
2.30.270.10 Mainly Beta Roll duf1285 protein fold duf1285 protein 2re3A02
3.10.540.10 Alpha Beta Roll duf1285 like fold duf1285 like domain 2re3A01
2DWVA 2BA1A 3KAFA 2ZQVA 3TDBA 2DMVA 1ZCNA 2ZQTA 1K9RA 3ODKA 2JXWA 2ZR5A 2DJYA 3KAHA 2ITKA 4U86A 2XP7A 3OOBA 3KABA 2YSFA 2EZ5W 2LAJA 2MDIA 3L4HA 2XP5A 2XP6A 2ZR6A 2DK1A 1PINA 2E45A 5AHTA 2XPBA 2ZAJA 2JMFA 2L4JA 3TCZA 2F21A 2ZR4A 4QIBA 2DK7A 1JMQA 3NTPA 3KCEA 2RA9A 2JX8A 2XP8A 4E5RA 1YW5A 2XP4A 1K9QA 3KADA 2YSGA 2ZQUA 3M7NA 3WH0A 2M3OW 1WMVA 1TK7A 2XP9A 4REXA 2YSIA 1WR7A 2KXQA 1F8AB 5CQ2A 2YSBA 2ZQSA 4U84A 2XPAA 2YSHA 3CNGA 4U85A 2RE3A 1O6WA 3KAIA 2M8JA 1EG3A 2XP3A 2Q5AA 3LE4A 1EG4A 3M85A 3TC5A 1I5HW 2M8IA 1NMVA 2JV4A 3KAGA
chains in the Genus database with same CATH superfamily
2VHQA 3IN9A 1TR8A 5E5WA 2DWVA 2BA1A 3KAFA 2VHUA 2ZQVA 3TDBA 2DMVA 1RP5A 3FS8A 1ZCNA 3MCBB 2ZQTA 1K9RA 3ODKA 2VHTA 2JXWA 2ZR5A 2DJYA 3KAHA 5E65A 2ITKA 1FLCA 1W47A 5E62A 4U86A 2XP7A 3KABA 3OOBA 2YSFA 2EZ5W 4BLTA 2LAJA 2MDIA 3L4HA 2XP5A 2XP6A 5E64A 2VHCA 3IKWA 2ZR6A 2DK1A 1PINA 2E45A 3FSCA 5AHTA 2XPBA 2ZAJA 2JMFA 3LKXA 3IMNA 2OWOA 2L4JA 3TCZA 2F21A 2ZR4A 4QIBA 2DK7A 1W48A 4GLXA 3MQHA 3INAA 1JMQA 3NTPA 3KCEA 1W49A 2RA9A 2WAEA 2JX8A 2XP8A 3ILRA 4E5RA 2Y8NB 1YW5A 1W46A 2XP4A 1K9QA 3KADA 2YSGA 1W44A 2ZQUA 1W4CA 3M7NA 5E66A 3WH0A 2M3OW 3MCBA 1YWYA 1WMVA 1TK7A 2VHJA 2XP9A 5U47A 1W4AA 4REXA 2YSIA 1WR7A 2KXQA 3FSBA 2WADA 4A0UA 1W4BA 1F8AB 5CQ2A 4BLSA 2YSBA 2ZQSA 3PQHA 2XPAA 4U84A 2YSHA 4A0TA 3CNGA 4U85A 2RE3A 1O6WA 3KAIA 2M8JA 3LKXB 1EG3A 3MQGA 2QRVA 4BLRA 2XP3A 2Q5AA 3LE4A 1EG4A 3M85A 2YAJB 3TC5A 1I5HW 2M8IA 1NMVA 2JV4A 3KAGA
chains in the Genus database with same CATH topology
1TR8A 5E5WA 2DWVA 2BA1A 3KAFA 2ZQVA 3TDBA 2DMVA 1RP5A 3FS8A 1ZCNA 3MCBB 2ZQTA 1K9RA 3ODKA 2JXWA 2ZR5A 2DJYA 3KAHA 5E65A 2ITKA 1FLCA 5E62A 4U86A 2XP7A 3KABA 3OOBA 2YSFA 2EZ5W 2LAJA 2MDIA 3L4HA 2XP5A 2XP6A 5E64A 2ZR6A 2DK1A 1PINA 2E45A 3FSCA 5AHTA 2XPBA 2ZAJA 2JMFA 3LKXA 2OWOA 2L4JA 3TCZA 2F21A 2ZR4A 4QIBA 2DK7A 4GLXA 3MQHA 1JMQA 3NTPA 3KCEA 2RA9A 2WAEA 2JX8A 2XP8A 4E5RA 2Y8NB 1YW5A 2XP4A 1K9QA 3KADA 2YSGA 2ZQUA 3M7NA 5E66A 3WH0A 2M3OW 3MCBA 1WMVA 1TK7A 2XP9A 5U47A 4REXA 2YSIA 1WR7A 2KXQA 3FSBA 2WADA 4A0UA 1F8AB 5CQ2A 2YSBA 2ZQSA 3PQHA 2XPAA 4U84A 2YSHA 4A0TA 3CNGA 4U85A 2RE3A 1O6WA 3KAIA 2M8JA 3LKXB 1EG3A 3MQGA 2QRVA 2XP3A 2Q5AA 3LE4A 1EG4A 3M85A 2YAJB 3TC5A 1I5HW 2M8IA 1NMVA 2JV4A 3KAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWV A;  2BA1 A;  3KAF A;  2ZQV A;  3TDB A;  2DMV A;  1ZCN A;  2ZQT A;  1K9R A;  3ODK A;  2JXW A;  2ZR5 A;  2DJY A;  3KAH A;  2ITK A;  4U86 A;  2XP7 A;  3OOB A;  3KAB A;  2YSF A;  2EZ5 W;  2LAJ A;  2MDI A;  3L4H A;  2XP5 A;  2XP6 A;  2ZR6 A;  2DK1 A;  1PIN A;  2E45 A;  5AHT A;  2XPB A;  2ZAJ A;  2JMF A;  2L4J A;  3TCZ A;  2F21 A;  2ZR4 A;  4QIB A;  2DK7 A;  1JMQ A;  3NTP A;  3KCE A;  2RA9 A;  2JX8 A;  2XP8 A;  4E5R A;  1YW5 A;  2XP4 A;  1K9Q A;  3KAD A;  2YSG A;  2ZQU A;  3M7N A;  3WH0 A;  2M3O W;  1WMV A;  1TK7 A;  2XP9 A;  4REX A;  2YSI A;  1WR7 A;  2KXQ A;  1F8A B;  5CQ2 A;  2YSB A;  2ZQS A;  4U84 A;  2XPA A;  2YSH A;  3CNG A;  4U85 A;  2RE3 A;  1O6W A;  3KAI A;  2M8J A;  1EG3 A;  2XP3 A;  2Q5A A;  3LE4 A;  1EG4 A;  3M85 A;  3TC5 A;  1I5H W;  2M8I A;  1NMV A;  2JV4 A;  3KAG A; 
#chains in the Genus database with same CATH topology
 2VHQ A;  3IN9 A;  1TR8 A;  5E5W A;  2DWV A;  2BA1 A;  3KAF A;  2VHU A;  2ZQV A;  3TDB A;  2DMV A;  1RP5 A;  3FS8 A;  1ZCN A;  3MCB B;  2ZQT A;  1K9R A;  3ODK A;  2VHT A;  2JXW A;  2ZR5 A;  2DJY A;  3KAH A;  5E65 A;  2ITK A;  1FLC A;  1W47 A;  5E62 A;  4U86 A;  2XP7 A;  3KAB A;  3OOB A;  2YSF A;  2EZ5 W;  4BLT A;  2LAJ A;  2MDI A;  3L4H A;  2XP5 A;  2XP6 A;  5E64 A;  2VHC A;  3IKW A;  2ZR6 A;  2DK1 A;  1PIN A;  2E45 A;  3FSC A;  5AHT A;  2XPB A;  2ZAJ A;  2JMF A;  3LKX A;  3IMN A;  2OWO A;  2L4J A;  3TCZ A;  2F21 A;  2ZR4 A;  4QIB A;  2DK7 A;  1W48 A;  4GLX A;  3MQH A;  3INA A;  1JMQ A;  3NTP A;  3KCE A;  1W49 A;  2RA9 A;  2WAE A;  2JX8 A;  2XP8 A;  3ILR A;  4E5R A;  2Y8N B;  1YW5 A;  1W46 A;  2XP4 A;  1K9Q A;  3KAD A;  2YSG A;  1W44 A;  2ZQU A;  1W4C A;  3M7N A;  5E66 A;  3WH0 A;  2M3O W;  3MCB A;  1YWY A;  1WMV A;  1TK7 A;  2VHJ A;  2XP9 A;  5U47 A;  1W4A A;  4REX A;  2YSI A;  1WR7 A;  2KXQ A;  3FSB A;  2WAD A;  4A0U A;  1W4B A;  1F8A B;  5CQ2 A;  4BLS A;  2YSB A;  2ZQS A;  3PQH A;  2XPA A;  4U84 A;  2YSH A;  4A0T A;  3CNG A;  4U85 A;  2RE3 A;  1O6W A;  3KAI A;  2M8J A;  3LKX B;  1EG3 A;  3MQG A;  2QRV A;  4BLR A;  2XP3 A;  2Q5A A;  3LE4 A;  1EG4 A;  3M85 A;  2YAJ B;  3TC5 A;  1I5H W;  2M8I A;  1NMV A;  2JV4 A;  3KAG A; 
#chains in the Genus database with same CATH homology
 1TR8 A;  5E5W A;  2DWV A;  2BA1 A;  3KAF A;  2ZQV A;  3TDB A;  2DMV A;  1RP5 A;  3FS8 A;  1ZCN A;  3MCB B;  2ZQT A;  1K9R A;  3ODK A;  2JXW A;  2ZR5 A;  2DJY A;  3KAH A;  5E65 A;  2ITK A;  1FLC A;  5E62 A;  4U86 A;  2XP7 A;  3KAB A;  3OOB A;  2YSF A;  2EZ5 W;  2LAJ A;  2MDI A;  3L4H A;  2XP5 A;  2XP6 A;  5E64 A;  2ZR6 A;  2DK1 A;  1PIN A;  2E45 A;  3FSC A;  5AHT A;  2XPB A;  2ZAJ A;  2JMF A;  3LKX A;  2OWO A;  2L4J A;  3TCZ A;  2F21 A;  2ZR4 A;  4QIB A;  2DK7 A;  4GLX A;  3MQH A;  1JMQ A;  3NTP A;  3KCE A;  2RA9 A;  2WAE A;  2JX8 A;  2XP8 A;  4E5R A;  2Y8N B;  1YW5 A;  2XP4 A;  1K9Q A;  3KAD A;  2YSG A;  2ZQU A;  3M7N A;  5E66 A;  3WH0 A;  2M3O W;  3MCB A;  1WMV A;  1TK7 A;  2XP9 A;  5U47 A;  4REX A;  2YSI A;  1WR7 A;  2KXQ A;  3FSB A;  2WAD A;  4A0U A;  1F8A B;  5CQ2 A;  2YSB A;  2ZQS A;  3PQH A;  2XPA A;  4U84 A;  2YSH A;  4A0T A;  3CNG A;  4U85 A;  2RE3 A;  1O6W A;  3KAI A;  2M8J A;  3LKX B;  1EG3 A;  3MQG A;  2QRV A;  2XP3 A;  2Q5A A;  3LE4 A;  1EG4 A;  3M85 A;  2YAJ B;  3TC5 A;  1I5H W;  2M8I A;  1NMV A;  2JV4 A;  3KAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...