2RE3A

Crystal structure of a duf1285 family protein (spo_0140) from silicibacter pomeroyi dss-3 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
183
structure length
183
Chain Sequence
SADGLLASARAIKSKGPAPVHLWNPPFNGDIDMRIARDGTWFYQGTPINRPAMVRLFSSILKREEDRFYLVTPVEKVGIRVDDAPFVAVDVEVAGQGRKQVLTFTTHVGDSAVAGEGNPIRMAQDPATGEPAPYVHVRAGLEALIDRKSFYRLMDLGEIEDGWFGLWSSGSFFPLMTVEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction.
pubmed doi rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Unknown function
total genus 40
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06938 DUF1285 Protein of unknown function (DUF1285)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2re3A03
2.30.270.10 Mainly Beta Roll duf1285 protein fold duf1285 protein 2re3A02
3.10.540.10 Alpha Beta Roll duf1285 like fold duf1285 like domain 2re3A01
1K9QA 2RA9A 2XP8A 2BA1A 1YW5A 3KADA 3KCEA 4U84A 2JMFA 2YSGA 2JXWA 2XP9A 3M85A 2ZQUA 3KAGA 2YSHA 1K9RA 2E45A 5CQ2A 3KAIA 2ZR6A 2DWVA 3NTPA 3CNGA 4U86A 3TDBA 2JX8A 2XP4A 1JMQA 4U85A 2XP3A 2L4JA 3WH0A 3TC5A 3L4HA 2ZQVA 1TK7A 2LAJA 2Q5AA 3KAHA 4E5RA 4REXA 2JV4A 1NMVA 2DK7A 2DJYA 2M3OW 2ITKA 2ZAJA 2ZQSA 5AHTA 1EG4A 2F21A 1I5HW 2M8IA 2ZR4A 2YSBA 2M8JA 3KAFA 3ODKA 3M7NA 2MDIA 3KABA 1O6WA 2YSFA 2ZR5A 1WMVA 1EG3A 2XP7A 2XPBA 2ZQTA 2DK1A 3LE4A 3TCZA 2XP5A 1ZCNA 3OOBA 2KXQA 2YSIA 1WR7A 2RE3A 4QIBA 2EZ5W 2XP6A 1PINA 2DMVA 1F8AB 2XPAA
chains in the Genus database with same CATH superfamily
1K9QA 2RA9A 2XP8A 2BA1A 1YW5A 3KADA 3KCEA 4U84A 3MQGA 3FSBA 1W49A 2JMFA 3IN9A 2YSGA 2JXWA 2XP9A 3M85A 1W48A 2VHCA 2ZQUA 3KAGA 5E64A 2YSHA 1K9RA 2E45A 5CQ2A 3KAIA 2ZR6A 2DWVA 5E65A 3NTPA 2VHQA 3CNGA 2Y8NB 4U86A 3MCBB 4BLTA 3ILRA 3TDBA 2VHUA 4BLSA 2JX8A 2XP4A 3IKWA 1JMQA 4U85A 1W4CA 2XP3A 2L4JA 3LKXA 3WH0A 2QRVA 3TC5A 3L4HA 2ZQVA 1TK7A 3LKXB 2LAJA 3PQHA 4A0UA 2Q5AA 2OWOA 3KAHA 1W4BA 2WADA 4E5RA 4REXA 1W47A 2JV4A 1NMVA 3MQHA 2DK7A 2DJYA 2M3OW 2ITKA 5U47A 1FLCA 2ZAJA 2ZQSA 2YAJB 2VHJA 5AHTA 1EG4A 2F21A 3FS8A 1I5HW 1W4AA 3FSCA 1W44A 5E66A 4A0TA 2M8IA 2ZR4A 2YSBA 2M8JA 3KAFA 2WAEA 3ODKA 3M7NA 2MDIA 3KABA 1O6WA 2YSFA 2ZR5A 5E62A 3IMNA 1WMVA 1EG3A 1RP5A 2XP7A 2XPBA 2ZQTA 3INAA 2DK1A 3LE4A 5E5WA 3TCZA 4BLRA 2XP5A 1ZCNA 3OOBA 2KXQA 4GLXA 2YSIA 1WR7A 2VHTA 2RE3A 1W46A 4QIBA 2EZ5W 1TR8A 2XP6A 1PINA 2DMVA 3MCBA 1F8AB 1YWYA 2XPAA
chains in the Genus database with same CATH topology
1K9QA 2RA9A 2XP8A 2BA1A 1YW5A 3KADA 3KCEA 4U84A 3MQGA 3FSBA 2JMFA 2YSGA 2JXWA 2XP9A 3M85A 2ZQUA 3KAGA 5E64A 2YSHA 1K9RA 2E45A 5CQ2A 3KAIA 2ZR6A 2DWVA 5E65A 3NTPA 3CNGA 2Y8NB 4U86A 3MCBB 3TDBA 2JX8A 2XP4A 1JMQA 4U85A 2XP3A 2L4JA 3LKXA 3WH0A 2QRVA 3TC5A 3L4HA 2ZQVA 1TK7A 3LKXB 2LAJA 3PQHA 4A0UA 2Q5AA 2OWOA 3KAHA 2WADA 4E5RA 4REXA 2JV4A 1NMVA 3MQHA 2DK7A 2DJYA 2M3OW 2ITKA 5U47A 1FLCA 2ZAJA 2ZQSA 2YAJB 5AHTA 1EG4A 2F21A 3FS8A 1I5HW 3FSCA 5E66A 4A0TA 2M8IA 2ZR4A 2YSBA 2M8JA 3KAFA 2WAEA 3ODKA 3M7NA 2MDIA 3KABA 1O6WA 2YSFA 2ZR5A 5E62A 1WMVA 1EG3A 1RP5A 2XP7A 2XPBA 2ZQTA 2DK1A 3LE4A 5E5WA 3TCZA 2XP5A 1ZCNA 3OOBA 2KXQA 4GLXA 2YSIA 1WR7A 2RE3A 4QIBA 2EZ5W 1TR8A 2XP6A 1PINA 2DMVA 3MCBA 1F8AB 2XPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9Q A;  2RA9 A;  2XP8 A;  2BA1 A;  1YW5 A;  3KAD A;  3KCE A;  4U84 A;  2JMF A;  2YSG A;  2JXW A;  2XP9 A;  3M85 A;  2ZQU A;  3KAG A;  2YSH A;  1K9R A;  2E45 A;  5CQ2 A;  3KAI A;  2ZR6 A;  2DWV A;  3NTP A;  3CNG A;  4U86 A;  3TDB A;  2JX8 A;  2XP4 A;  1JMQ A;  4U85 A;  2XP3 A;  2L4J A;  3WH0 A;  3TC5 A;  3L4H A;  2ZQV A;  1TK7 A;  2LAJ A;  2Q5A A;  3KAH A;  4E5R A;  4REX A;  2JV4 A;  1NMV A;  2DK7 A;  2DJY A;  2M3O W;  2ITK A;  2ZAJ A;  2ZQS A;  5AHT A;  1EG4 A;  2F21 A;  1I5H W;  2M8I A;  2ZR4 A;  2YSB A;  2M8J A;  3KAF A;  3ODK A;  3M7N A;  2MDI A;  3KAB A;  1O6W A;  2YSF A;  2ZR5 A;  1WMV A;  1EG3 A;  2XP7 A;  2XPB A;  2ZQT A;  2DK1 A;  3LE4 A;  3TCZ A;  2XP5 A;  1ZCN A;  3OOB A;  2KXQ A;  2YSI A;  1WR7 A;  2RE3 A;  4QIB A;  2EZ5 W;  2XP6 A;  1PIN A;  2DMV A;  1F8A B;  2XPA A; 
#chains in the Genus database with same CATH topology
 1K9Q A;  2RA9 A;  2XP8 A;  2BA1 A;  1YW5 A;  3KAD A;  3KCE A;  4U84 A;  3MQG A;  3FSB A;  1W49 A;  2JMF A;  3IN9 A;  2YSG A;  2JXW A;  2XP9 A;  3M85 A;  1W48 A;  2VHC A;  2ZQU A;  3KAG A;  5E64 A;  2YSH A;  1K9R A;  2E45 A;  5CQ2 A;  3KAI A;  2ZR6 A;  2DWV A;  5E65 A;  3NTP A;  2VHQ A;  3CNG A;  2Y8N B;  4U86 A;  3MCB B;  4BLT A;  3ILR A;  3TDB A;  2VHU A;  4BLS A;  2JX8 A;  2XP4 A;  3IKW A;  1JMQ A;  4U85 A;  1W4C A;  2XP3 A;  2L4J A;  3LKX A;  3WH0 A;  2QRV A;  3TC5 A;  3L4H A;  2ZQV A;  1TK7 A;  3LKX B;  2LAJ A;  3PQH A;  4A0U A;  2Q5A A;  2OWO A;  3KAH A;  1W4B A;  2WAD A;  4E5R A;  4REX A;  1W47 A;  2JV4 A;  1NMV A;  3MQH A;  2DK7 A;  2DJY A;  2M3O W;  2ITK A;  5U47 A;  1FLC A;  2ZAJ A;  2ZQS A;  2YAJ B;  2VHJ A;  5AHT A;  1EG4 A;  2F21 A;  3FS8 A;  1I5H W;  1W4A A;  3FSC A;  1W44 A;  5E66 A;  4A0T A;  2M8I A;  2ZR4 A;  2YSB A;  2M8J A;  3KAF A;  2WAE A;  3ODK A;  3M7N A;  2MDI A;  3KAB A;  1O6W A;  2YSF A;  2ZR5 A;  5E62 A;  3IMN A;  1WMV A;  1EG3 A;  1RP5 A;  2XP7 A;  2XPB A;  2ZQT A;  3INA A;  2DK1 A;  3LE4 A;  5E5W A;  3TCZ A;  4BLR A;  2XP5 A;  1ZCN A;  3OOB A;  2KXQ A;  4GLX A;  2YSI A;  1WR7 A;  2VHT A;  2RE3 A;  1W46 A;  4QIB A;  2EZ5 W;  1TR8 A;  2XP6 A;  1PIN A;  2DMV A;  3MCB A;  1F8A B;  1YWY A;  2XPA A; 
#chains in the Genus database with same CATH homology
 1K9Q A;  2RA9 A;  2XP8 A;  2BA1 A;  1YW5 A;  3KAD A;  3KCE A;  4U84 A;  3MQG A;  3FSB A;  2JMF A;  2YSG A;  2JXW A;  2XP9 A;  3M85 A;  2ZQU A;  3KAG A;  5E64 A;  2YSH A;  1K9R A;  2E45 A;  5CQ2 A;  3KAI A;  2ZR6 A;  2DWV A;  5E65 A;  3NTP A;  3CNG A;  2Y8N B;  4U86 A;  3MCB B;  3TDB A;  2JX8 A;  2XP4 A;  1JMQ A;  4U85 A;  2XP3 A;  2L4J A;  3LKX A;  3WH0 A;  2QRV A;  3TC5 A;  3L4H A;  2ZQV A;  1TK7 A;  3LKX B;  2LAJ A;  3PQH A;  4A0U A;  2Q5A A;  2OWO A;  3KAH A;  2WAD A;  4E5R A;  4REX A;  2JV4 A;  1NMV A;  3MQH A;  2DK7 A;  2DJY A;  2M3O W;  2ITK A;  5U47 A;  1FLC A;  2ZAJ A;  2ZQS A;  2YAJ B;  5AHT A;  1EG4 A;  2F21 A;  3FS8 A;  1I5H W;  3FSC A;  5E66 A;  4A0T A;  2M8I A;  2ZR4 A;  2YSB A;  2M8J A;  3KAF A;  2WAE A;  3ODK A;  3M7N A;  2MDI A;  3KAB A;  1O6W A;  2YSF A;  2ZR5 A;  5E62 A;  1WMV A;  1EG3 A;  1RP5 A;  2XP7 A;  2XPB A;  2ZQT A;  2DK1 A;  3LE4 A;  5E5W A;  3TCZ A;  2XP5 A;  1ZCN A;  3OOB A;  2KXQ A;  4GLX A;  2YSI A;  1WR7 A;  2RE3 A;  4QIB A;  2EZ5 W;  1TR8 A;  2XP6 A;  1PIN A;  2DMV A;  3MCB A;  1F8A B;  2XPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...