The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
7
|
sequence length |
42
|
structure length |
42
|
Chain Sequence |
TTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Analysis of the Recognition of the Negative Regulator Nmra and DNA by the Zinc Finger from the Gata-Type Transcription Factor Area.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| source organism |
Emericella nidulans
|
| molecule keywords |
NITROGEN METABOLITE REPRESSION REGULATOR NMRA
|
| total genus |
7
|
| structure length |
42
|
| sequence length |
42
|
| chains with identical sequence |
J, K, L, M, N, O, P
|
| ec nomenclature | |
| pdb deposition date | 2008-05-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| I | PF00320 | GATA | GATA zinc finger |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Erythroid Transcription Factor GATA-1; Chain A | Erythroid Transcription Factor GATA-1, subunit A |
#chains in the Genus database with same CATH superfamily 2C7A A; 1LV3 A; 1R4I A; 5EMQ A; 4IQR A; 3DZY D; 3VD6 C; 4CN2 C; 3DFV C; 1RXR A; 1LO1 A; 3G8X A; 5L0M A; 5CBY A; 1KB2 A; 2FF0 A; 3E00 D; 1A6Y A; 3DZU A; 4HCA A; 1R4O A; 2VUU I; 3VEK C; 5E6C A; 1KB4 A; 5EMP A; 5E6B A; 1HRA A; 2NLL A; 2VUS I; 4OLN A; 4CN3 A; 1YNW B; 3GAT A; 5E6A A; 1YNW A; 4TMA I; 5EMC A; 5CBX A; 4AA6 A; 5E6D A; 4HC7 A; 1CIT A; 3G6Q A; 1R4R A; 1KB6 A; 2EBL A; 3G6P A; 4CN7 A; 3DZY A; 2HAN B; 5KRB B; 2HAN A; 2NLL B; 3G97 A; 3G9I A; 3G9O A; 4NQA B; 3FYL A; 3DFX A; 3G9J A; 3G6U A; 4OND A; 3E00 A; 4OOR A; 1BY4 A; 1RGD A; 2GDA A; 5E69 A; 1GA5 A; 5GAT A; 2ENV A; 1HCP A; 2GAT A; 2VUT I; 4HN5 A; 1R0O B; 1GAU A; 1HLZ A; 1R0O A; 3G99 A; 7GAT A; 1GDC A; 4CN5 A; 2M9W A; 3DZU D; 1R0N A; 3G9M A; 4TNT A; 3G6R A; 5CC0 A; 3G8U A; 6GAT A; 3G9P A; 5CBZ A; 1HCQ A; 4CN3 D; 3G6T A; 4GAT A; 2KAE A; 3M9E A; 5CC1 A; 1DSZ B; 1GAT A; 4OV7 A; 1DSZ A; 3CBB A; 4HN6 A; 4HC9 A; 1GLU A; 1LAT A; 1R0N B; 1GNF A; 2A66 A; #chains in the Genus database with same CATH topology 2C7A A; 1LV3 A; 1R4I A; 5EMQ A; 4IQR A; 3DZY D; 3VD6 C; 4CN2 C; 3DFV C; 1RXR A; 1LO1 A; 3G8X A; 5L0M A; 5CBY A; 1KB2 A; 2FF0 A; 3E00 D; 1A6Y A; 3DZU A; 4HCA A; 1R4O A; 2VUU I; 3VEK C; 5E6C A; 1KB4 A; 5EMP A; 5E6B A; 1HRA A; 2NLL A; 2VUS I; 4OLN A; 4CN3 A; 1YNW B; 3GAT A; 5E6A A; 1YNW A; 4TMA I; 5EMC A; 5CBX A; 2DS5 A; 4AA6 A; 5E6D A; 4HC7 A; 1CIT A; 3G6Q A; 1R4R A; 1KB6 A; 2EBL A; 3G6P A; 4CN7 A; 2DS8 A; 3DZY A; 2HAN B; 5KRB B; 2HAN A; 2NLL B; 3G97 A; 3G9I A; 3G9O A; 4NQA B; 3FYL A; 3DFX A; 3G9J A; 3G6U A; 4OND A; 3G27 A; 3E00 A; 4OOR A; 1BY4 A; 1RGD A; 2GDA A; 5E69 A; 1GA5 A; 5GAT A; 2ENV A; 1HCP A; 2GAT A; 2VUT I; 4HN5 A; 1R0O B; 1GAU A; 1HLZ A; 1R0O A; 3G99 A; 7GAT A; 1GDC A; 4CN5 A; 2M9W A; 3DZU D; 1R0N A; 3G9M A; 4TNT A; 3G6R A; 5CC0 A; 3G8U A; 6GAT A; 3G9P A; 5CBZ A; 1HCQ A; 4CN3 D; 2DS6 A; 3G6T A; 4GAT A; 2KAE A; 3M9E A; 5CC1 A; 1DSZ B; 1GAT A; 4OV7 A; 1DSZ A; 3CBB A; 4HN6 A; 4HC9 A; 1GLU A; 1LAT A; 1R0N B; 1GNF A; 2A66 A; #chains in the Genus database with same CATH homology 2C7A A; 1LV3 A; 1R4I A; 5EMQ A; 4IQR A; 3DZY D; 3VD6 C; 4CN2 C; 3DFV C; 1RXR A; 1LO1 A; 3G8X A; 5L0M A; 5CBY A; 1KB2 A; 2FF0 A; 3E00 D; 1A6Y A; 3DZU A; 4HCA A; 1R4O A; 2VUU I; 3VEK C; 5E6C A; 1KB4 A; 5EMP A; 5E6B A; 1HRA A; 2NLL A; 2VUS I; 4OLN A; 4CN3 A; 1YNW B; 3GAT A; 5E6A A; 1YNW A; 4TMA I; 5EMC A; 5CBX A; 4AA6 A; 5E6D A; 4HC7 A; 1CIT A; 3G6Q A; 1R4R A; 1KB6 A; 2EBL A; 3G6P A; 4CN7 A; 3DZY A; 2HAN B; 5KRB B; 2HAN A; 2NLL B; 3G97 A; 3G9I A; 3G9O A; 4NQA B; 3FYL A; 3DFX A; 3G9J A; 3G6U A; 4OND A; 3E00 A; 4OOR A; 1BY4 A; 1RGD A; 2GDA A; 5E69 A; 1GA5 A; 5GAT A; 2ENV A; 1HCP A; 2GAT A; 2VUT I; 4HN5 A; 1R0O B; 1GAU A; 1HLZ A; 1R0O A; 3G99 A; 7GAT A; 1GDC A; 4CN5 A; 2M9W A; 3DZU D; 1R0N A; 3G9M A; 4TNT A; 3G6R A; 5CC0 A; 3G8U A; 6GAT A; 3G9P A; 5CBZ A; 1HCQ A; 4CN3 D; 3G6T A; 4GAT A; 2KAE A; 3M9E A; 5CC1 A; 1DSZ B; 1GAT A; 4OV7 A; 1DSZ A; 3CBB A; 4HN6 A; 4HC9 A; 1GLU A; 1LAT A; 1R0N B; 1GNF A; 2A66 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
