The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
78
|
structure length |
78
|
Chain Sequence |
NPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
ATP SYNTHASE C CHAIN, CHLOROPLASTIC
|
| publication title |
Structure of the c14 rotor ring of the proton translocating chloroplast ATP synthase.
pubmed doi rcsb |
| total genus |
23
|
| structure length |
78
|
| sequence length |
78
|
| chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L, M, V
|
| ec nomenclature |
ec
3.6.3.14: Transferred entry: 7.1.2.2. |
| pdb deposition date | 2008-12-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00137 | ATP-synt_C | ATP synthase subunit C |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | F1FO ATP Synthase | F1F0 ATP synthase subunit C |
#chains in the Genus database with same CATH superfamily 4CBK A; 1L6T A; 2WGM A; 4V1G A; 4CBJ A; 2WPD J; 5FL7 K; 2WIE A; 2W5J A; 1C17 A; 4F4S A; 5DN6 J; 4BEM A; 3V3C A; 1WU0 A; 4V1F A; 4CBJ C; 2XOK K; 2XQU A; 1A91 A; 1C99 A; 5BPS A; 1IJP A; 1C0V A; 2X2V A; 5BQJ A; 2XND J; 1YCE A; 3U2Y K; 5BQA A; 3U32 K; 3ZK1 A; 3UD0 K; 2XQT A; 3U2F K; 4V1H A; 3ZK2 A; 1ATY A; 2XQS A; 5BQ6 A; #chains in the Genus database with same CATH topology 4CBK A; 1L6T A; 2WGM A; 3MAY A; 4V1G A; 4CBJ A; 2WPD J; 5FL7 K; 2WIE A; 2W5J A; 1C17 A; 4F4S A; 5DN6 J; 4BEM A; 3V3C A; 1WU0 A; 4V1F A; 4CBJ C; 2XOK K; 2XQU A; 1A91 A; 1C99 A; 5BPS A; 1IJP A; 1C0V A; 2X2V A; 5BQJ A; 2XND J; 1YCE A; 3U2Y K; 5BQA A; 3U32 K; 3ZK1 A; 3UD0 K; 2XQT A; 3U2F K; 4V1H A; 3ZK2 A; 1ATY A; 2XQS A; 5BQ6 A; 3NB0 A; #chains in the Genus database with same CATH homology 4CBK A; 1L6T A; 2WGM A; 4V1G A; 4CBJ A; 2WPD J; 5FL7 K; 2WIE A; 2W5J A; 1C17 A; 4F4S A; 5DN6 J; 4BEM A; 3V3C A; 1WU0 A; 4V1F A; 4CBJ C; 2XOK K; 2XQU A; 1A91 A; 1C99 A; 5BPS A; 1IJP A; 1C0V A; 2X2V A; 5BQJ A; 2XND J; 1YCE A; 3U2Y K; 5BQA A; 3U32 K; 3ZK1 A; 3UD0 K; 2XQT A; 3U2F K; 4V1H A; 3ZK2 A; 1ATY A; 2XQS A; 5BQ6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
