The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
127
|
structure length |
127
|
Chain Sequence |
GADDDKPIQVNQLPQTAQTFIKTHFPDNKVAMAKMETDWFDKSYDVIFTNGDKLEFDKKGIWTEVNCKYSAVPVAVVPDAIKKYVATNYPDAKMLKIERDKHDYEVKLSNGWEIKFDMQFNVIDIDN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Unknown function
|
molecule keywords |
Putative periplasmic protein
|
publication title |
The structure of BVU2987 from Bacteroides vulgatus reveals a superfamily of bacterial periplasmic proteins with possible inhibitory function.
pubmed doi rcsb |
source organism |
Bacteroides vulgatus atcc 8482
|
total genus |
24
|
structure length |
127
|
sequence length |
127
|
ec nomenclature | |
pdb deposition date | 2008-07-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11396 | PepSY_like | Putative beta-lactamase-inhibitor-like, PepSY-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Inhibitor of vertebrate lysozyme, Ivy | Inhibitor of vertebrate lysozyme, Ivy |
#chains in the Genus database with same CATH superfamily 4POI A; 4QOA A; 3DUE A; 4DSD A; 3DB7 A; 3ELG A; #chains in the Genus database with same CATH topology 4POI A; 3CWX A; 4QOA A; 1GPQ A; 3DUE A; 1UUZ A; 4PS6 A; 4DSD A; 3DB7 A; 3CWY A; 1XS0 A; 3ELG A; #chains in the Genus database with same CATH homology 4POI A; 3CWX A; 4QOA A; 3DUE A; 4DSD A; 3DB7 A; 3CWY A; 3ELG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...