The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
193
|
structure length |
193
|
Chain Sequence |
STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Immune system
|
source organism |
Homo sapiens
|
publication title |
Structural Insights into the Down-regulation of Overexpressed p185her2/neu Protein of Transformed Cells by the Antibody chA21.
pubmed doi rcsb |
molecule keywords |
Receptor tyrosine-protein kinase erbB-2
|
total genus |
60
|
structure length |
193
|
sequence length |
193
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.7.10.1: Receptor protein-tyrosine kinase. |
pdb deposition date | 2009-04-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01030 | Recep_L_domain | Receptor L domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Horseshoe | 24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A | Receptor L-domain |
#chains in the Genus database with same CATH superfamily 1YY9 A; 3P11 A; 3H3B A; 4P59 A; 4KRO A; 1IVO A; 1NQL A; 3NJP A; 3U9U E; 4KRP A; 2HR7 A; 1S78 A; 3B2V A; 1IGR A; 3BE1 A; 3U2P A; 1N8Z C; 3C09 A; 3WLW A; 3LTG A; 3WSQ A; 4KRL A; 4XSS E; 3U7U A; 4OGA E; 3N85 A; 3B2U A; 3I2T A; 1N8Y C; 1M6B A; 3LTF A; 4HRL C; 4LEO C; 5SX5 M; 4HRM A; 4XST E; 5J3H E; 3MZW A; 3P0Y A; 2AHX A; 4KRM A; 3QWQ A; 2A91 A; 4UV7 A; 3W11 E; 5SX4 M; 1MOX A; #chains in the Genus database with same CATH topology 1YY9 A; 3P11 A; 3H3B A; 4P59 A; 4KRO A; 1IVO A; 1NQL A; 3NJP A; 3U9U E; 4KRP A; 2HR7 A; 1S78 A; 3B2V A; 1IGR A; 3BE1 A; 3U2P A; 1N8Z C; 3C09 A; 3WLW A; 3LTG A; 3WSQ A; 4KRL A; 4XSS E; 3U7U A; 4OGA E; 3N85 A; 3B2U A; 3I2T A; 1N8Y C; 1M6B A; 3LTF A; 4HRL C; 4LEO C; 5SX5 M; 4HRM A; 4XST E; 5J3H E; 3MZW A; 3P0Y A; 2AHX A; 4KRM A; 3QWQ A; 2A91 A; 4UV7 A; 3W11 E; 5SX4 M; 1MOX A; #chains in the Genus database with same CATH homology 1YY9 A; 3P11 A; 3H3B A; 4P59 A; 4KRO A; 1IVO A; 1NQL A; 3NJP A; 3U9U E; 4KRP A; 2HR7 A; 1S78 A; 3B2V A; 1IGR A; 3BE1 A; 3U2P A; 1N8Z C; 3C09 A; 3WLW A; 3LTG A; 3WSQ A; 4KRL A; 4XSS E; 3U7U A; 4OGA E; 3N85 A; 3B2U A; 3I2T A; 1N8Y C; 1M6B A; 3LTF A; 4HRL C; 4LEO C; 5SX5 M; 4HRM A; 4XST E; 5J3H E; 3MZW A; 3P0Y A; 2AHX A; 4KRM A; 3QWQ A; 2A91 A; 4UV7 A; 3W11 E; 5SX4 M; 1MOX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...