3J81m

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
ETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Ribosome
source organism Saccharomyces cerevisiae
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
m PF01253 SUI1 Translation initiation factor SUI1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.780.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor Eif1 SUI1-like domain 3j81m00
3JAMj 1D1RA 3J7Yg 2OGHA 4V1Al 2RVHA 2IF1A 3J81m 4MO0A 3J80j
chains in the Genus database with same CATH superfamily
3JAMj 2KX2A 3J7Yg 1D1RA 2OCAA 2OGHA 4V1Al 1RIFA 2RVHA 2IF1A 3J81m 4MO0A 3J80j
chains in the Genus database with same CATH topology
3JAMj 1D1RA 3J7Yg 2OGHA 4V1Al 2RVHA 2IF1A 3J81m 4MO0A 3J80j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM j;  1D1R A;  3J7Y g;  2OGH A;  4V1A l;  2RVH A;  2IF1 A;  3J81 m;  4MO0 A;  3J80 j; 
#chains in the Genus database with same CATH topology
 3JAM j;  2KX2 A;  3J7Y g;  1D1R A;  2OCA A;  2OGH A;  4V1A l;  1RIF A;  2RVH A;  2IF1 A;  3J81 m;  4MO0 A;  3J80 j; 
#chains in the Genus database with same CATH homology
 3JAM j;  1D1R A;  3J7Y g;  2OGH A;  4V1A l;  2RVH A;  2IF1 A;  3J81 m;  4MO0 A;  3J80 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...