The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
83
|
structure length |
83
|
Chain Sequence |
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structures of low molecular weight inhibitors bound to MDMX and MDM2 reveal new approaches for p53-MDMX/MDM2 antagonist drug discovery
pubmed doi rcsb |
molecule tags |
Cell cycle
|
source organism |
Homo sapiens
|
molecule keywords |
Protein Mdm4
|
total genus |
24
|
structure length |
83
|
sequence length |
83
|
ec nomenclature | |
pdb deposition date | 2010-01-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF02201 | SWIB | SWIB/MDM2 domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | MDM2 | SWIB/MDM2 domain |
#chains in the Genus database with same CATH superfamily 1YCQ A; 3JZP A; 4HG7 A; 3JZS A; 4JV7 A; 4UMN A; 3FE7 A; 5TRF A; 4QO4 A; 3VBG A; 3LNJ A; 2M86 B; 2MPS A; 4WT2 A; 5LAY A; 5HMK A; 3U15 A; 4J74 A; 1T4E A; 5HMI A; 4ZYC A; 3DAC A; 5LAZ A; 5LN2 A; 4LWV A; 1Z1M A; 4J7E A; 4MDN A; 4HBM A; 4OGT A; 3LBL A; 4LWT A; 4JVR A; 4IPF A; 1UHR A; 5AFG A; 4RXZ A; 4JRG A; 4HFZ A; 4ZYF A; 4OCC A; 4ZYI A; 4ODE A; 4JV9 A; 4OGN A; 4ERE A; 4JSC A; 2N14 A; 3LBJ E; 3EQY A; 4MDQ A; 1RV1 A; 4ZFI A; 4J7D A; 4OQ3 A; 4LWU A; 2GV2 A; 1V32 A; 4N5T A; 3V3B A; 4ERF A; 1TTV A; 2LZG A; 3FDO A; 4ODF A; 3JZQ A; 3LNZ A; 4QOC A; 3TJ2 A; 3FEA A; 3TU1 A; 5HMH A; 2Z5S M; 3JZO A; 2N0W A; 1V31 A; 4OGV A; 3W69 A; 4J3E A; 4UE1 A; 3IWY A; 5LAW A; 2MWY A; 4ZGK A; 4OAS A; 2VYR A; 2N06 A; 3IUX A; 4DIJ A; 3G03 A; 2Z5T M; 3JZR A; 2RUH A; 3VZV A; 4JWR A; 4JVE A; 3TPX A; 1T4F M; 3JZK A; 5LAV A; 5C5A A; 3EQS A; 3DAB A; 3LBK A; 1YCR A; 2N0U A; 4UD7 A; 4OBA A; 2AXI A; #chains in the Genus database with same CATH topology 1YCQ A; 3JZP A; 4HG7 A; 3JZS A; 4JV7 A; 4UMN A; 3FE7 A; 5TRF A; 4QO4 A; 3VBG A; 3LNJ A; 2M86 B; 2MPS A; 4WT2 A; 5LAY A; 5HMK A; 3U15 A; 4J74 A; 1T4E A; 5HMI A; 4ZYC A; 3DAC A; 5LAZ A; 5LN2 A; 4LWV A; 1Z1M A; 4J7E A; 4MDN A; 4HBM A; 4OGT A; 3LBL A; 4LWT A; 4JVR A; 4IPF A; 1UHR A; 5AFG A; 4RXZ A; 4JRG A; 4HFZ A; 4ZYF A; 4OCC A; 4ZYI A; 4ODE A; 4JV9 A; 4OGN A; 4ERE A; 4JSC A; 2N14 A; 3LBJ E; 3EQY A; 4MDQ A; 1RV1 A; 4ZFI A; 4J7D A; 4OQ3 A; 4LWU A; 2GV2 A; 1V32 A; 4N5T A; 3V3B A; 4ERF A; 1TTV A; 2LZG A; 3FDO A; 4ODF A; 3JZQ A; 3LNZ A; 4QOC A; 3TJ2 A; 3FEA A; 3TU1 A; 5HMH A; 2Z5S M; 3JZO A; 2N0W A; 1V31 A; 4OGV A; 3W69 A; 4J3E A; 4UE1 A; 3IWY A; 5LAW A; 2MWY A; 4ZGK A; 4OAS A; 2VYR A; 2N06 A; 3IUX A; 4DIJ A; 3G03 A; 2Z5T M; 3JZR A; 2RUH A; 3VZV A; 4JWR A; 4JVE A; 3TPX A; 1T4F M; 3JZK A; 5LAV A; 5C5A A; 3EQS A; 3DAB A; 3LBK A; 1YCR A; 2N0U A; 4UD7 A; 4OBA A; 2AXI A; #chains in the Genus database with same CATH homology 1YCQ A; 3JZP A; 4HG7 A; 3JZS A; 4JV7 A; 4UMN A; 3FE7 A; 5TRF A; 4QO4 A; 3VBG A; 3LNJ A; 2M86 B; 2MPS A; 4WT2 A; 5LAY A; 5HMK A; 3U15 A; 4J74 A; 1T4E A; 5HMI A; 4ZYC A; 3DAC A; 5LAZ A; 5LN2 A; 4LWV A; 1Z1M A; 4J7E A; 4MDN A; 4HBM A; 4OGT A; 3LBL A; 4LWT A; 4JVR A; 4IPF A; 1UHR A; 5AFG A; 4RXZ A; 4JRG A; 4HFZ A; 4ZYF A; 4OCC A; 4ZYI A; 4ODE A; 4JV9 A; 4OGN A; 4ERE A; 4JSC A; 2N14 A; 3LBJ E; 3EQY A; 4MDQ A; 1RV1 A; 4ZFI A; 4J7D A; 4OQ3 A; 4LWU A; 2GV2 A; 1V32 A; 4N5T A; 3V3B A; 4ERF A; 1TTV A; 2LZG A; 3FDO A; 4ODF A; 3JZQ A; 3LNZ A; 4QOC A; 3TJ2 A; 3FEA A; 3TU1 A; 5HMH A; 2Z5S M; 3JZO A; 2N0W A; 1V31 A; 4OGV A; 3W69 A; 4J3E A; 4UE1 A; 3IWY A; 5LAW A; 2MWY A; 4ZGK A; 4OAS A; 2VYR A; 2N06 A; 3IUX A; 4DIJ A; 3G03 A; 2Z5T M; 3JZR A; 2RUH A; 3VZV A; 4JWR A; 4JVE A; 3TPX A; 1T4F M; 3JZK A; 5LAV A; 5C5A A; 3EQS A; 3DAB A; 3LBK A; 1YCR A; 2N0U A; 4UD7 A; 4OBA A; 2AXI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...