The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
205
|
structure length |
193
|
Chain Sequence |
SHANINAFKEAVTKIDRVEINRRLELAYAYNASIAGAKYPALKDPYVVEYARMLEVKEQIGHVIIPRINQDIPIYAGSAEENLQRGVGHLEGTSLPVGGESTHAVLTAHRGLPTAKLFTNLDKVTVGDRFYIEHIGGKIAYQVDQIKVIAPDQLEDLYVIQGEDHVTLLTCTPYMINSHRLLVRGKRIPYVEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural differences between the Streptococcus agalactiae housekeeping and pilus-specific sortases: SrtA and SrtC1.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Streptococcus agalactiae serogroup v
|
molecule keywords |
Sortase family protein
|
total genus |
52
|
structure length |
193
|
sequence length |
205
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-03-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04203 | Sortase | Sortase domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Sortase; Chain: A; | Sortase |
#chains in the Genus database with same CATH superfamily 4UX7 A; 5GYJ A; 5K9A A; 1T2P A; 3TB7 A; 4G1H A; 5CUW A; 4G1J A; 3PSQ A; 5B23 A; 1NG5 A; 4O8T A; 1RZ2 A; 3RBI A; 2WTS A; 2KID A; 3G69 A; 2MLM A; 4O8L B; 3G66 A; 3RE9 A; 4LFD A; 2W1K A; 4Y4Q A; 2OQW A; 3RCC A; 1IJA A; 2RUI A; 1QWZ A; 2OQZ A; 2KW8 A; 3RBJ A; 1QX6 A; 3RBK A; 3FN5 A; 2XWG A; 3O0P A; 1QXA A; 4D70 A; 3FN6 A; 3TBE A; 5GO5 A; 5JCV A; 4O8L A; 1T2O A; 3FN7 A; 4D7W A; 2W1J A; 2LN7 A; 1T2W A; #chains in the Genus database with same CATH topology 4UX7 A; 5GYJ A; 5K9A A; 1T2P A; 3TB7 A; 4G1H A; 5CUW A; 4G1J A; 3PSQ A; 5B23 A; 1NG5 A; 4O8T A; 1RZ2 A; 3RBI A; 2WTS A; 2KID A; 3G69 A; 2MLM A; 4O8L B; 3G66 A; 3RE9 A; 4LFD A; 2W1K A; 4Y4Q A; 2OQW A; 3RCC A; 1IJA A; 2RUI A; 1QWZ A; 2OQZ A; 2KW8 A; 3RBJ A; 1QX6 A; 3RBK A; 3FN5 A; 2XWG A; 3O0P A; 1QXA A; 4D70 A; 3FN6 A; 3TBE A; 5GO5 A; 5JCV A; 4O8L A; 1T2O A; 3FN7 A; 4D7W A; 2W1J A; 2LN7 A; 1T2W A; #chains in the Genus database with same CATH homology 4UX7 A; 5GYJ A; 5K9A A; 1T2P A; 3TB7 A; 4G1H A; 5CUW A; 4G1J A; 3PSQ A; 5B23 A; 1NG5 A; 4O8T A; 1RZ2 A; 3RBI A; 2WTS A; 2KID A; 3G69 A; 2MLM A; 4O8L B; 3G66 A; 3RE9 A; 4LFD A; 2W1K A; 4Y4Q A; 2OQW A; 3RCC A; 1IJA A; 2RUI A; 1QWZ A; 2OQZ A; 2KW8 A; 3RBJ A; 1QX6 A; 3RBK A; 3FN5 A; 2XWG A; 3O0P A; 1QXA A; 4D70 A; 3FN6 A; 3TBE A; 5GO5 A; 5JCV A; 4O8L A; 1T2O A; 3FN7 A; 4D7W A; 2W1J A; 2LN7 A; 1T2W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...