The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
136
|
structure length |
132
|
Chain Sequence |
SCGCFEAIMAILPECNGIMITTRDHAGMTPSGMTFSTLAGMIQTPGFMGIGRTYIVSKKFISADGGIARIVWMPKSLKDFLHDEFVRRSVEEGLGEDFIDKIADETIGTTVDEILPYLEEKGHPALTMDPIM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
molecule keywords |
acetyl-CoA synthase subunit alpha
|
publication title |
Insights into the Mechanistic Role of the [Fe(4) S(4) ] Cubane in the A-Cluster {[Fe(4) S(4) ]-(SR)-[Ni(p) Ni(d) ]} of Acetyl-Coenzyme A Synthase.
pubmed doi rcsb |
source organism |
Moorella thermoacetica
|
total genus |
38
|
structure length |
132
|
sequence length |
136
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.3.1.169: CO-methylating acetyl-CoA synthase. |
pdb deposition date | 2011-05-17 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 5 | Bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs), Chain M, domain 5 |
#chains in the Genus database with same CATH superfamily 1MJG M; 5H6W A; 1OAO C; 3I01 M; 3GIT A; 3I04 M; 2Z8Y M; 3S2X A; 1RU3 A; #chains in the Genus database with same CATH topology 1MJG M; 5H6W A; 1OAO C; 3I01 M; 3GIT A; 3I04 M; 2Z8Y M; 3S2X A; 1RU3 A; #chains in the Genus database with same CATH homology 1MJG M; 5H6W A; 1OAO C; 3I01 M; 3GIT A; 3I04 M; 2Z8Y M; 3S2X A; 1RU3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...