The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
48
|
structure length |
48
|
Chain Sequence |
GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Metal-mediated affinity and orientation specificity in a computationally designed protein homodimer.
pubmed doi rcsb |
molecule tags |
De novo protein, metal binding protein
|
source organism |
Artificial gene
|
molecule keywords |
Computational design, MID1-apo1
|
total genus |
19
|
structure length |
48
|
sequence length |
48
|
ec nomenclature | |
pdb deposition date | 2011-12-09 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | DNA Excision Repair, Uvrb; Chain A | Rabenosyn, Rab binding domain |
#chains in the Genus database with same CATH superfamily 3V1E A; 3V1A A; 3V1B A; 3V1C A; 3V1F A; 1Z0K B; 3V1D A; 3DKQ A; 1Z0J B; 1YZM A; #chains in the Genus database with same CATH topology 3V1E A; 1QOJ A; 1E52 A; 1YSM A; 2A26 A; 3V1B A; 3V1C A; 3V1A A; 3V1F A; 3PXG A; 4U1C A; 1Z0K B; 3V1D A; 3DKQ A; 1Z0J B; 1YZM A; 2LF0 A; #chains in the Genus database with same CATH homology 3V1E A; 3V1A A; 3V1B A; 3V1C A; 3V1F A; 1Z0K B; 3V1D A; 3DKQ A; 1Z0J B; 1YZM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...