The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
195
|
structure length |
195
|
Chain Sequence |
EEKKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for EGF receptor inhibition by the therapeutic antibody IMC-11F8.
pubmed doi rcsb |
| molecule keywords |
IMC-11F8 Fab Light chain
|
| molecule tags |
Immune system/transferase
|
| source organism |
Homo sapiens
|
| total genus |
61
|
| structure length |
195
|
| sequence length |
195
|
| chains with identical sequence |
B, E, I, M, P, S, V
|
| ec nomenclature |
ec
2.7.10.1: Receptor protein-tyrosine kinase. |
| pdb deposition date | 2007-10-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01030 | Recep_L_domain | Receptor L domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Horseshoe | 24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A | Receptor L-domain |
#chains in the Genus database with same CATH superfamily 3WSQ A; 2HR7 A; 3BE1 A; 3LTF A; 4XST E; 1NQL A; 5SX5 M; 3P11 A; 3W11 E; 1IVO A; 1IGR A; 4KRP A; 1N8Z C; 2A91 A; 4OGA E; 3NJP A; 3B2U A; 3N85 A; 4HRL C; 1N8Y C; 4P59 A; 4XSS E; 3QWQ A; 3WLW A; 1S78 A; 5J3H E; 3I2T A; 4KRM A; 3H3B A; 3LTG A; 4LEO C; 1MOX A; 4HRM A; 4UV7 A; 3C09 A; 1M6B A; 4KRL A; 4KRO A; 3U7U A; 3B2V A; 3U2P A; 3P0Y A; 2AHX A; 1YY9 A; 3U9U E; 3MZW A; 5SX4 M; #chains in the Genus database with same CATH topology 3WSQ A; 2HR7 A; 3BE1 A; 3LTF A; 4XST E; 1NQL A; 5SX5 M; 3P11 A; 3W11 E; 1IVO A; 1IGR A; 4KRP A; 1N8Z C; 2A91 A; 4OGA E; 3NJP A; 3B2U A; 3N85 A; 4HRL C; 1N8Y C; 4P59 A; 4XSS E; 3QWQ A; 3WLW A; 1S78 A; 5J3H E; 3I2T A; 4KRM A; 3H3B A; 3LTG A; 4LEO C; 1MOX A; 4HRM A; 4UV7 A; 3C09 A; 1M6B A; 4KRL A; 4KRO A; 3U7U A; 3B2V A; 3U2P A; 3P0Y A; 2AHX A; 1YY9 A; 3U9U E; 3MZW A; 5SX4 M; #chains in the Genus database with same CATH homology 3WSQ A; 2HR7 A; 3BE1 A; 3LTF A; 4XST E; 1NQL A; 5SX5 M; 3P11 A; 3W11 E; 1IVO A; 1IGR A; 4KRP A; 1N8Z C; 2A91 A; 4OGA E; 3NJP A; 3B2U A; 3N85 A; 4HRL C; 1N8Y C; 4P59 A; 4XSS E; 3QWQ A; 3WLW A; 1S78 A; 5J3H E; 3I2T A; 4KRM A; 3H3B A; 3LTG A; 4LEO C; 1MOX A; 4HRM A; 4UV7 A; 3C09 A; 1M6B A; 4KRL A; 4KRO A; 3U7U A; 3B2V A; 3U2P A; 3P0Y A; 2AHX A; 1YY9 A; 3U9U E; 3MZW A; 5SX4 M;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...