3BQWA

Crystal structure of the putative capsid protein of prophage (e.coli cft073)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
347
structure length
347
Chain Sequence
b'AMALNTNQLFAYLNRGDIAEFKFSPLFTTLFFPNVATFSTQNIMLDTLDIEEVTMSAFCSPMVGSQVQRDKGYETSTIKPGYMKPKHEIDPTKTIMRMAGEDPAQLNDPTYRRMRLITGNMRRQINAIKARVEWLAVNAVTTGKNIIEGEGIERYEIDWKIPEKNIIEQADGKKWSEQDKETHYPIYDIELYADQAGCPANVMIMGAEVWRTLRSFKKFRELYDLSRGSESAAELACKNLGEVVSFKGYLGDLALIVYSGKYTDSDGTEKYFLEPDLLVLGNTNNKGLVAYGAIMDQEAVRTGATQNMFYPKNWIEDGDPAIEYVQTHSAPQPVPADIRKFVTVKIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative capsid protein of prophage
publication title The crystal structure of the putative capsid protein of prophage (E.coli CFT073).
rcsb
source organism Escherichia coli cft073
molecule tags Structural genomics, unknown function
total genus 98
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03864 Phage_cap_E Phage major capsid protein E
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.30.10 Alpha Beta Super Roll putative capsid protein of prophage fold putative capsid protein of prophage domain like 3bqwA01
3.30.1930.10 Alpha Beta 2-Layer Sandwich capsid protein of prophage fold capsid protein of prophage domain 3bqwA02
3BQWA
chains in the Genus database with same CATH superfamily
3BQWA
chains in the Genus database with same CATH topology
3BQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQW A; 
#chains in the Genus database with same CATH topology
 3BQW A; 
#chains in the Genus database with same CATH homology
 3BQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...