The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
103
|
structure length |
103
|
Chain Sequence |
ICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMEC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb |
| molecule keywords |
E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
|
| molecule tags |
Ligase/signaling protein
|
| source organism |
Mus musculus
|
| total genus |
16
|
| structure length |
103
|
| sequence length |
103
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2013-10-02 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A domain 2 | Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2A91 A; 3P11 A; 4KNG M; 4LI2 B; 3U2P A; 4XST E; 4C9R B; 3B2V A; 4C9U B; 1M6B A; 5J3H E; 3I2T A; 4KT1 E; 3W11 E; 4CDK E; 3N85 A; 4C8V A; 4KRO A; 4BSP A; 4C9V B; 3LTF A; 4UFR B; 1IGR A; 4OGA E; 4P59 A; 3BE1 A; 1MOX A; 4BSS C; 1IVO A; 1S78 A; 4XSS E; 3LTG A; 4KRP A; 3WSQ A; 4BSO A; 4BSU C; 4C99 B; 3U7U A; 3QWQ A; 4BSR C; 4C8W I; 3WLW A; 4C9E B; 1YY9 A; 3NJP A; 4UV7 A; 3MZW A; 4QXF C; 1N8Y C; 1N8Z C; 2AHX A; 3U9U E; 4C9A B; 1NQL A; 4LEO C; 2HR7 A; 4HRN C; #chains in the Genus database with same CATH topology 2A91 A; 3P11 A; 4KNG M; 4LI2 B; 3U2P A; 4XST E; 4C9R B; 3B2V A; 4C9U B; 1M6B A; 5J3H E; 3I2T A; 4KT1 E; 3W11 E; 4CDK E; 3N85 A; 4C8V A; 4KRO A; 4BSP A; 4C9V B; 3LTF A; 4UFR B; 1IGR A; 4OGA E; 4P59 A; 3BE1 A; 1MOX A; 4BSS C; 1IVO A; 1S78 A; 4XSS E; 3LTG A; 4KRP A; 3WSQ A; 4BSO A; 4BSU C; 4C99 B; 3U7U A; 3QWQ A; 4BSR C; 4C8W I; 3WLW A; 4C9E B; 1YY9 A; 3NJP A; 4UV7 A; 3MZW A; 4QXF C; 1N8Y C; 1N8Z C; 2AHX A; 3U9U E; 4C9A B; 1NQL A; 4LEO C; 2HR7 A; 4HRN C; #chains in the Genus database with same CATH homology 2A91 A; 3P11 A; 4KNG M; 4LI2 B; 3U2P A; 4XST E; 4C9R B; 3B2V A; 4C9U B; 1M6B A; 5J3H E; 3I2T A; 4KT1 E; 3W11 E; 4CDK E; 3N85 A; 4C8V A; 4KRO A; 4BSP A; 4C9V B; 3LTF A; 4UFR B; 1IGR A; 4OGA E; 4P59 A; 3BE1 A; 1MOX A; 4BSS C; 1IVO A; 1S78 A; 4XSS E; 3LTG A; 4KRP A; 3WSQ A; 4BSO A; 4BSU C; 4C99 B; 3U7U A; 3QWQ A; 4BSR C; 4C8W I; 3WLW A; 4C9E B; 1YY9 A; 3NJP A; 4UV7 A; 3MZW A; 4QXF C; 1N8Y C; 1N8Z C; 2AHX A; 3U9U E; 4C9A B; 1NQL A; 4LEO C; 2HR7 A; 4HRN C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...