The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
106
|
structure length |
106
|
Chain Sequence |
ANPAENIASEISKSVEGAIQQVKNLLTLAADRAEQIVNDLASTTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAMESLEEALK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A Soluble Mutant of the Transmembrane Receptor Af1503 Features Strong Changes in Coiled-Coil Periodicity.
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Archaeoglobus fulgidus
|
molecule keywords |
ENGINEERED VERSION OF TRANSMEMBRANE RECEPTOR AF1503
|
total genus |
46
|
structure length |
106
|
sequence length |
106
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2014-02-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00672 | HAMP | HAMP domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | hypothetical protein mp506/mpn330, domain 1 | hypothetical protein mp506/mpn330, domain 1 |
#chains in the Genus database with same CATH superfamily 4CQ4 A; 4GN0 A; #chains in the Genus database with same CATH topology 4L3U A; 2JUA A; 1P68 A; 4CQ4 A; 1V9V A; 2M9X A; 1TD6 A; 4GN0 A; 3VJF A; #chains in the Genus database with same CATH homology 4CQ4 A; 4L3U A; 4GN0 A; 1TD6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...