The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
169
|
structure length |
166
|
Chain Sequence |
TYNLTSDIDAAAYLEELKQNPIINNKIMNPVGQCESLMTPVSNFMNEKGFDNIRYRGIFIWDKPTEEIPTNHFAVVGNKEGKDYVFDVSAHQFENRGMSNLNGPLILSADEWVCKYRMAKLIYYTDFSNSSIAANAYDALPRELESESMAGKVFVTSPRWFNTFKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the catalytic domain of the Salmonella virulence factor SseI.
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| source organism |
Salmonella enterica subsp. enterica serovar typhimurium
|
| molecule keywords |
Secreted effector protein sseI
|
| total genus |
45
|
| structure length |
166
|
| sequence length |
169
|
| ec nomenclature | |
| pdb deposition date | 2012-07-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF15645 | Tox-PLDMTX | Dermonecrotoxin of the Papain-like fold |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Secreted effector protein ssei fold | Secreted effector protein ssei. |
#chains in the Genus database with same CATH superfamily 4G2B A; 2EBH X; 2EC5 A; 4G29 A; 2EBF X; #chains in the Genus database with same CATH topology 4G2B A; 2EBH X; 2EC5 A; 4G29 A; 2EBF X; #chains in the Genus database with same CATH homology 4G2B A; 2EBH X; 2EC5 A; 4G29 A; 2EBF X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
