The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
129
|
structure length |
129
|
Chain Sequence |
NELQSAAEELNAMLQYARSEAVSQRRAISIQALKDKDWGKGLSIGVLASGSIAAPLRKHDGFRAATLTAKEKSAVEHLTFTANGTLVPPTERTFAICQNGKTDGGRVLSISQAGRIQLEPSSKAPQSCY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Cell adhesion
|
molecule keywords |
FimU protein
|
publication title |
Minor pilin FimU controls P. aeruginosa type IV pilus extension/retraction dynamics independently of other minor components
rcsb |
source organism |
Pseudomonas aeruginosa
|
total genus |
30
|
structure length |
129
|
sequence length |
129
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-01-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12019 | GspH | Type II transport protein GspH |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bab) Sandwich | minor pseudopilin epsh fold | minor pseudopilin epsh domain |
#chains in the Genus database with same CATH superfamily 4IPU A; 4IPV A; 2QV8 A; 4DQ9 A; 2KNQ A; #chains in the Genus database with same CATH topology 4IPU A; 4IPV A; 2QV8 A; 4DQ9 A; 2KNQ A; #chains in the Genus database with same CATH homology 4IPU A; 4IPV A; 2QV8 A; 4DQ9 A; 2KNQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...