4V1Al

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
133
structure length
133
Chain Sequence
EYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
molecule tags Ribosome
total genus 19
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.780.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor Eif1 SUI1-like domain 4v1al00
2RVHA 3J7Yg 4V1Al 2OGHA 3J81m 4MO0A 2IF1A 1D1RA 3JAMj 3J80j
chains in the Genus database with same CATH superfamily
1RIFA 2OCAA 2RVHA 3J7Yg 4V1Al 2OGHA 2KX2A 3J81m 4MO0A 2IF1A 1D1RA 3JAMj 3J80j
chains in the Genus database with same CATH topology
2RVHA 3J7Yg 4V1Al 2OGHA 3J81m 4MO0A 2IF1A 1D1RA 3JAMj 3J80j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVH A;  3J7Y g;  4V1A l;  2OGH A;  3J81 m;  4MO0 A;  2IF1 A;  1D1R A;  3JAM j;  3J80 j; 
#chains in the Genus database with same CATH topology
 1RIF A;  2OCA A;  2RVH A;  3J7Y g;  4V1A l;  2OGH A;  2KX2 A;  3J81 m;  4MO0 A;  2IF1 A;  1D1R A;  3JAM j;  3J80 j; 
#chains in the Genus database with same CATH homology
 2RVH A;  3J7Y g;  4V1A l;  2OGH A;  3J81 m;  4MO0 A;  2IF1 A;  1D1R A;  3JAM j;  3J80 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...