The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
ELDPNALITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGIARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPGLQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the Mycobacterial ATP Synthase Fo Rotor Ring in Complex with Iodo-Bedaquiline
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
F0F1 ATP SYNTHASE SUBUNIT C
|
total genus |
34
|
structure length |
85
|
sequence length |
85
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
3.6.3.14: Transferred entry: 7.1.2.2. |
pdb deposition date | 2014-09-26 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | F1FO ATP Synthase | F1F0 ATP synthase subunit C |
#chains in the Genus database with same CATH superfamily 2WGM A; 4V1G A; 3ZK2 A; 1A91 A; 3U2F K; 2WPD J; 2X2V A; 3UD0 K; 2WIE A; 1WU0 A; 4V1F A; 5BPS A; 1IJP A; 4BEM A; 5DN6 J; 4CBJ A; 5BQJ A; 2XQU A; 1C99 A; 2XQS A; 2XQT A; 4V1H A; 4CBJ C; 4F4S A; 5FL7 K; 2XOK K; 3U2Y K; 1C0V A; 1L6T A; 1C17 A; 1YCE A; 3U32 K; 3V3C A; 3ZK1 A; 5BQ6 A; 2W5J A; 4CBK A; 1ATY A; 5BQA A; 2XND J; #chains in the Genus database with same CATH topology 2WGM A; 4V1G A; 3ZK2 A; 1A91 A; 3U2F K; 2WPD J; 2X2V A; 3UD0 K; 3MAY A; 2WIE A; 1WU0 A; 4V1F A; 5BPS A; 1IJP A; 4BEM A; 5DN6 J; 4CBJ A; 5BQJ A; 2XQU A; 1C99 A; 2XQS A; 2XQT A; 4V1H A; 4CBJ C; 4F4S A; 5FL7 K; 3NB0 A; 2XOK K; 3U2Y K; 1C0V A; 1L6T A; 1C17 A; 1YCE A; 3U32 K; 3V3C A; 3ZK1 A; 5BQ6 A; 2W5J A; 4CBK A; 1ATY A; 5BQA A; 2XND J; #chains in the Genus database with same CATH homology 2WGM A; 4V1G A; 3ZK2 A; 1A91 A; 3U2F K; 2WPD J; 2X2V A; 3UD0 K; 2WIE A; 1WU0 A; 4V1F A; 5BPS A; 1IJP A; 4BEM A; 5DN6 J; 4CBJ A; 5BQJ A; 2XQU A; 1C99 A; 2XQS A; 2XQT A; 4V1H A; 4CBJ C; 4F4S A; 5FL7 K; 2XOK K; 3U2Y K; 1C0V A; 1L6T A; 1C17 A; 1YCE A; 3U32 K; 3V3C A; 3ZK1 A; 5BQ6 A; 2W5J A; 4CBK A; 1ATY A; 5BQA A; 2XND J;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...