The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
STYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPSCSLMIDVVHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the Elongator cofactor complex Kti11/Kti13 provides insight into the role of Kti13 in Elongator-dependent tRNA modification.
pubmed doi rcsb |
| molecule keywords |
Diphthamide biosynthesis protein 3
|
| molecule tags |
Electron transport
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
10
|
| structure length |
60
|
| sequence length |
60
|
| ec nomenclature | |
| pdb deposition date | 2014-11-27 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Microbial ribonuclease fold | DPH Zinc finger |
#chains in the Genus database with same CATH superfamily 4D4P A; 1YOP A; 5AX2 A; 1WGE A; 1YWS A; 4D4O A; 4X33 A; 2L6L A; 2JR7 A; #chains in the Genus database with same CATH topology 4D4P A; 1YOP A; 5AX2 A; 1WGE A; 1YWS A; 4D4O A; 4X33 A; 2L6L A; 2JR7 A; #chains in the Genus database with same CATH homology 4D4P A; 1YOP A; 5AX2 A; 1WGE A; 1YWS A; 4D4O A; 4X33 A; 2L6L A; 2JR7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...