2L6LA

Solution structure of human j-protein co-chaperone, dph4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 24
publication title Solution structure of human J-protein cochaperone Dph4
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF05207 zf-CSL CSL zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2l6lA01
3.10.660.10 Alpha Beta Roll Microbial ribonuclease fold DPH Zinc finger 2l6lA02
1N4CA 3UCSC 2Y4TA 3AG7A 1WJZA 1BQ0A 2L6LA 2LO1A 2PF4E 2N04A 2OCHA 3APOA 2QWRB 3BVOA 2DN9A 1YOPA 3UO2A 2CUGA 1YWSA 4J7ZA 4D4PA 4IT5A 3UO3A 4D4OA 1FPOA 2JR7A 1IURA 2CTQA 2EJ7A 4J80A 5AX2A 4X33A 2GUZB 2CTWA 2QWPB 2QSAA 2YS8A 1XBLA 2CTRA 2Y4UA 4RWUA 2YUAA 3APQA 1BQZA 1WGEA 1HDJA 2QWQB 2M6YA 2QWNB 2DMXA 1GH6A 2CTPA 2LGWA 2GUZA 2KQXA 1FAFA 1NZ6A 2QWOB 2N05A
chains in the Genus database with same CATH superfamily
4MSWC 4JTCB 3IC7A 4HNAA 1QLEB 3GVMA 4LFAO 3B8MA 4BWAA 2JEXA 5EIBC 3CCMV 1V55C 2YIDA 4FFBA 4R50A 3S3WA 5EYPB 4YIOA 4DR2B 4L87A 3WG7C 4OX9O 4MVUA 1GRJA 4WFEA 2EZOA 3TETA 2ZXWB 3OT7A 4YIPA 3RGBA 2UUAO 3AG4B 3SR2C 3LSUA 4L8JA 1TA8A 2ZD9A 3THOA 3CCLV 1YITV 4X64B 1CP9A 2VQEB 4G27B 1XL4A 4LF4B 1YDXA 4Z1MG 5K1XA 4DV3O 4BIZA 4IYIA 3ZRWA 4I5SA 3OFNG 4YJ2B 2MK3A 5IWAO 1O9GA 2EJ7A 1MNGA 3E8FA 5KUMA 1FFXA 3QNEA 4JI0B 5KAFZ 2ZR2A 1VIBA 4UUJC 2UXDO 4DV5O 1KKDA 1W0JG 5KHIA 3LDEA 4DV1O 4JTDB 1S5JA 3CC7V 4UVBA 4TUYB 4I7ZB 3G6BA 2GTSA 3ABLC 3OGIB 2ZM6O 3HKBB 5IYZA 1N34O 1H8HG 5JH7B 1KYOF 2F43G 2WLMA 3O9OA 3M99B 1ROPA 4JI6O 2E5LB 2GUZA 4CH6A 1FFTB 4OXSA 1M56C 4NVPA 2CGOA 3VOUA 1ZAUA 2AZ0A 1JFFA 4H0LB 1XL6A 5J2UA 3H9VA 2L35A 3HKCB 1VF7A 4FLXA 1V54B 2WLHA 2F23A 4LF7B 3K5NA 3SPHA 4LF6B 3CRMA 4UVAA 2GHYA 4CC6A 5LBQA 4X9QA 5EBWC 4ZI7B 4FM1A 2EJRA 2WA3A 1F7YA 1HNWO 2JGUA 4LF5O 2G38A 4I4TA 3RYHA 2ZE7A 4DV6B 4EB6A 2UXCO 2R9RB 1P7GA 5L3CA 2CK3G 1R6KA 1N8RW 3L9DA 3RYCA 3FYIB 4JI8O 4R7CA 3ZS8C 3STZC 3H1JH 3CD6V 3KCYA 3WFVA 1R3JC 2YDEA 4BAYA 4IIJB 1YXBA 3CRCA 1EN5A 4G28B 4RQEA 3K57A 2JJ1G 1XOUA 4JI1O 3S3XA 2PYJA 1WGEA 2B1IA 4LWSB 2EIKB 4X8AA 2X6CA 3FB5C 1Z5VA 3QTCA 1YOPA 2P67A 4ZHQA 1QQCA 5EZYA 3ZN0A 1JCHA 5B1NA 4JGSA 4QNHB 1AP6A 4DR3B 3UT5A 4CC5A 2X6BA 1SRYA 2ZE5A 3DC6A 2ZE8A 2QM8A 4IGGA 4O2BA 3L73H 2IU0A 1VQ5V 4Q6GA 3B09A 1FS0G 4FM2A 3BFRA 3AG2B 2IJIA 1PM9A 1L8DA 2XNDG 2UUBB 5EIBD 3ZHQA 3N27A 1EN6A 2WLKA 4X89A 2QWRB 4JYBA 4FLZA 5IDJA 1VQ4V 5IYBO 4LF4O 5JJEB 4K8ZA 1D5NA 3OE7G 3JYCA 5BMVB 5BY1A 1RSOB 2UUCB 1HR0B 2NR5A 2QKSA 5JQGA 2DE0X 1WJZA 1V9PA 1OCOC 2QM4A 1R3KC 2BOCC 3APOA 3JASB 1JOYA 1GN3A 3D3IA 3SJQC 1I5XA 2JR7A 2KSDA 4DYLA 2EIJC 4J11A 4LC1A 3K08A 1IXMA 2YSUB 5LGUA 1GH6A 3CRRA 2HVJC 1QR9A 4GX2A 2Y69C 1AB3A 1VARA 4PV1B 2YIBA 3K04A 1NS1A 1K4CC 5KAIZ 2VQFB 3VBBA 1K5QA 4LNUB 5LL6Y 1DF5A 4MVOA 2PTMA 4X1YA 2CAZC 3G6EV 1SA0B 1GN2A 3CCVV 1N33O 2DW4A 1O9HA 1H2SB 3UCSC 1IBLB 1HWYA 1ZUQA 4Q20A 4RUFA 1KB9F 2ZIMA 1PPJH 3LNNA 3FB6C 3IJ4A 4CZZA 4GLXA 4DR1B 4YHHO 3CYOA 2HJDA 2LP7A 1WP8A 1DK1A 3RVZA 3K3WA 4DV6O 5KA5A 3W7XA 4HAMA 1OJHA 5EC1C 1PL0A 1L0LH 5LA6B 4UXNA 2W6IG 3ASNC 1XMQO 2EINB 2JK5C 4YXWG 4JI3O 1QBZA 5IT9N 3BPZA 1I94O 4CH4A 3TJTA 4DK0A 1J5EB 4UCRA 1LUVA 2W0XA 4U3JA 4ZBMA 1YSCA 1Z2GA 4IL6Z 3LDCA 4FLTA 2ZKOA 2D3OW 3MD0A 4XDKA 3RVYA 5FPRA 1OV9A 1Y66A 4NTXA 5BR8B 2VWKA 3JAKB 5BXZA 4F6EA 4GUNA 2XASA 1KKCA 3KKYA 4PA6A 4LFBO 3E8HA 2B1GA 3JD1A 5L3GA 1JX9A 2EILC 3J80N 2YC0A 5GONA 2N74A 2DQ0A 3CEIA 3PN1A 1GK9A 3JALA 3K59A 4UVCA 1K8AW 2RJZA 4ZOLA 3K5OA 2OTJV 4I55A 3ZMVA 4TWKA 1F51A 4AQYB 2HHHB 4DR5O 1PNKA 1F4NA 5C8YB 3WU2Z 1M9NA 3DXRA 2LGWA 4LF8O 5KHJA 5ITZA 5LYJB 1Q90D 1Y67A 5LHGA 1FJGO 2KB1A 2UUBO 2IJHA 1DGSA 2WLNA 1S0VA 1HDJA 4FVMA 4DUZB 3JATB 2F1MA 1FXKA 1QCEA 4WFGA 1QNMA 2OTLV 3VQYA 1IVSA 1W59A 5B1BC 2UUCO 3G4SV 2E76B 2PUSA 4DV7B 4NXMB 5DM6V 2Q73A 3D36A 2H8PC 4PDMA 3ICXA 2UU9O 2FL4A 4AI8A 5LP6A 2QTOA 1Q86W 3HB3B 1ZWIC 1FYJA 3STLC 2QGNA 2ILMA 3SPJA 2Q8VA 3HKDB 1S72V 3U11A 1BGYH 5L3EA 2LJ2A 1KP3A 1XNQO 5KX5A 3J81N 1BS3A 4O2AB 3ABUA 2DMXA 3K03A 4H13B 1CEZA 4MTXA 5BZBA 5LMUO 3KZIZ 1NU1H 3I56V 2JGDA 3O65A 3SPCA 1D5AA 1NTMH 4Z1VA 1IBMB 3SYCA 2QEXV 1YTFB 4K0KO 1XUQA 4WF9V 1OCZB 3D3QA 4DR7B 4MW3A 1YJWV 2WWWA 3ZIAG 4TV8B 2DYRC 1YVWA 2M6YA 2ODMA 4PI0A 1B6QA 1GAXA 2YEVA 3EVKA 4B3TB 1Q81W 4JYAB 4PA7A 2P6JA 1R73A 1CPYA 2FKXA 1P84F 5CB4A 1M93A 1AILA 5LYJA 3E22B 1PNMA 5JVDB 4DRXB 3RN4A 4CH5A 2QA4V 1JJ2U 1SQVH 1NJIW 2ARHA 4DV2O 1XMOO 4GKJO 4JI7O 5H6QA 5B3SC 2EIMB 2OIGA 4LBEC 4EFEA 1J5EO 1YJNV 3JATA 5CA0A 3G71V 1TVKA 5FL7G 1N36O 1XHZA 2NLJC 2C2AA 4YY3B 2ZQMA 4J10A 2CH7A 2ZT9B 3FAVA 3T1CA 4JAUA 4BW9A 4UV9A 1VQKV 2YXLA 3ZHUA 1DTOA 1IBKB 4FLVA 3ZRXA 4DV0O 3UKMA 1GTOA 4X1KB 4WBNB 1VQLV 4IT5A 4RAIA 4FM0A 1PD3A 1JQ0A 2XOKG 4D7SA 4PA3A 1NH2D 3N2GB 3QVNA 4ZIBA 2HHHO 3BA9A 2KQXA 1B3QA 3J7AU 4FPPA 2WLJA 2X6AA 1X59A 1T5EA 3ETDA 3AG7A 1RP3B 2XAFA 2YICA 4I9QA 4JAAA 4YJ3B 2HVKC 5LHIA 1X4TA 4LFCB 2WAMA 1E1RG 4D6TH 4I50B 4Z2WA 3I55V 5J2TB 4RWUA 3APQA 1Y74A 3MAQA 3X2QC 5IJ9A 1MA1A 3L72H 4JAVA 1AI5A 4CH3A 4U3FH 3ZHTA 3E8BA 1BQ0A 1GMGA 2A79B 3CXHF 1ZSPA 1NVPD 4J9ZB 4D7TA 1YHQV 1NR7A 1WN7A 3N2KA 1TGOA 3SYOA 2GBOA 1FXKC 2QTSA 2A0LA 1Q3EA 4AILC 1Y76B 4I0XA 3CX5F 2OT5A 3FFQA 5DEDA 5KMGB 2A06H 1FAFA 1G1XB 4G2KA 2AGAA 4DXWA 4NXMO 4JI2O 5K1PA 4N23A 4K8XA 2LW7A 3CC4V 1OCCC 3D36C 4J7KA 1KQSU 4IHJB 1NVPB 2LFSA 2HKOA 1ENVA 2UXNA 3ZMUA 2CTRA 3ASOB 1QU7A 4K35A 3ZN1A 4GKKB 1SKVA 4UB6Z 1XNRB 4JI5B 1MSDA 3JARB 5EYPA 1GKFA 3HR0A 5E79Z 1VF5B 2LFRA 4HZ3A 3C90A 2BTQB 4J7ZA 5LOVB 1WB7A 3HPLC 5B1AB 3ABKC 1IBMO 4TQDA 1BMFG 1M57C 2Q69A 1YEWA 1M5IA 2M7WA 4CBCA 1BL8A 3R66A 3OR7C 4DR7O 2RN9A 5B1BB 3ZCCA 3ABMC 5EBLC 3CRQA 4B3RB 2XHBA 4E2LA 4QGPA 1K34A 2BSKB 1WA8B 4LF9B 4B3SB 2Q0OC 4LH6A 4YJ2A 3CSXA 1ZL8B 4MTGA 1VMGA 2ZNJA 1AI4A 5KHGA 4QPKA 4OPAA 3P30A 2VRZA 1HNZB 3E35A 5JWPA 1AI6A 2F4VB 4JF3A 1R6TA 1MABG 3OTFA 2BOBC 1IURA 5B1OA 2FTKA 2EZPA 3W7TA 4O4IB 3L71H 5IJ0B 5H5NA 3CCQV 4TUYA 2DYSC 3LUTB 1XBLA 3GWOA 3ZRSA 2ZIOA 3DGEA 4YY3O 4CS4A 1XREA 3DSQA 1GN6A 3HKBA 1Q8IA 1KMIZ 5JH7A 4FFKA 1NTKH 2PF4E 3RYIB 3JAWB 3KCXA 2YI9A 4DR2O 5L3BA 4PD4F 3AK1A 3AG1B 3AG3C 1RM1C 4NB5A 4O4LB 2R70A 3B2EE 1XEQA 3HKCA 4NTWA 2Y4UA 3OMAB 2YUAA 5FNVB 3WB1A 2OWOA 2WPDG 2XT9A 1PV0A 3AK3A 1SQBH 3RYFB 4PELA 5H6RA 2VS0A 4ZI7A 3JSNA 4NTYA 5IYCO 2A9HA 4X64O 2YXHA 5FLXN 3ZMSA 2VQEO 5AX2A 1NQTA 1UFIA 3FD9A 3W7SA 4RQFA 2OCCC 3RBZA 5B3SB 2X0LA 3OTOB 3CJHB 2AXTZ 3DTUB 1J95A 4IYHA 1K73W 2HP8A 4P9PA 2FMLA 4JI0O 1A32A 4DR6B 3B8NA 1V55B 3CMAV 4TV9B 3OM3B 3EHBB 2P7TC 1K9MW 4IIJA 3OEEG 3WG7B 2ETNA 3W7WA 1K97A 2YXYA 1JPXA 2XAQA 1THZA 2EX3A 4DUYB 1VQPV 2WLIB 1EZVH 5LMNB 1FXHA 1NI8A 4JYYA 4EEQA 4OGQB 1TUBB 3NR7A 4LWSA 4MVZA 3T1YB 2DN9A 4DW1A 1SQFA 4ICGA 2E5LO 2K9PA 2AHYA 4J80A 1PP9H 4H37A 2OIEA 1WP7A 5J9PC 2NN4A 4F6RB 2CTPA 2LW1A 4HYOA 3D8CA 3H1HH 3TK1A 4LF7O 5IY5C 1S3JA 4LF6O 2RNBA 3TXQA 2UXBB 4X65B 2O57A 1QLEC 4MTOA 5L3DA 3CPWU 4QE9A 4X33A 1QHTA 3JAWA 3X2QB 1IZ3A 4U7NA 1KBHA 3T2MA 1S5HC 4J42A 1KC8W 4O4JB 1B04A 1W2BU 3ZX6A 2F66C 2P90A 4JI4B 3H1IH 3HKEB 2ADQB 2ZXWC 3QF7A 1SZTA 3SDLA 3ABLB 4X20B 3AG4C 3SYQA 5CA1B 3CS5A 5EC2C 3G67A 1M56B 2ZE6A 3CXCU 1VQMV 5BMVA 1RSOA 4MVQA 4JTAB 4X66B 1OCCB 3NXSA 4PJ0Z 4MS2A 2UXXA 1Y6XA 4D4OA 4XDJA 2P4KA 2QE7G 4MVMA 1MG1A 2A7WA 3JASA 2F4VO 2IH3C 4LFAB 1GM9A 1SQGA 1P4RA 3B4SA 2Y4TA 1SERA 4TOIA 3F5WC 1FXVA 3Q4HB 2OCHA 4DR3O 2F95B 2PI5A 4OX9B 4W4LA 1IXBA 1TUBA 3JD0A 4TT3G 1EZJA 2QKAA 4QE7A 4LNUA 3A0HZ 4E4EA 3GWKC 2JRIA 3K06A 4J9YB 4DV4B 1SA0A 3QG5A 3ABMB 2Q68A 4BW5A 1VEWA 1F23A 2EULA 3BVOA 3SGIA 4FMTA 3IFXA 2W0FC 4X1IB 4O4HB 5JCOA 4DV3B 2WSSG 1V54C 1L0NH 5LXTB 3F7YC 2XUMA 1I7FA 1SC5B 5KHHA 3KG2A 1AR5A 5IWAB 1BT8A 1UPGA 5E1AC 1N0JA 3A2FA 1E79G 3ZHSA 3JAMN 1P49A 4LP8A 2KG7B 4XBFA 1VF6A 1HR0O 1XQ8A 2UXDB 4DV5B 3P3NA 1QR8A 2DWEC 4FLUA 5LA6A 4GZRB 4DV1B 1BZKA 4UFZA 1NR1A 1MOFA 3TCUA 2QWNB 4LH7A 3CC2V 4HNAB 5HFLA 4ASUG 1U97A 4FZ0A 2ZM6B 5DN6G 1N34B 5CN0A 2GV9A 4FFBB 4QPJA 2Y48A 2RDCA 2IH1C 3OMIB 4UCUA 4H44B 1YF2A 4F4LA 5L3FA 1U96A 3JAKA 3OEHG 3EFFK 2VQFO 2Y0PA 1ZLZA 3M7MX 1SS3A 2EIKC 3JD2A 2P4VA 2B5UA 3AK2A 2D2CB 2N04A 3ETEA 3CMEV 1PNLA 1IBLO 2PY5A 1BHBA 2IBZH 3C3TA 2UXBO 4X65O 1EFRG 3ZRWB 1JA8A 3CE2A 2UXCB 4DR1O 1HNXB 5C8YA 3VQVA 4KFMA 1OCOB 4KL1A 4LCUC 2L6LA 5D5QA 1DF4A 1JVMA 1FFXB 4JI8B 1H2NA 4J41A 1LNQA 5F2VO 4B7KA 2ITDC 2EIJB 1M90W 4UCOA 2CTWA 2Q7HA 4KUMA 1SQQH 1YZBA 3CCJV 1GM7A 3ZHRA 3RW0A 2Y69B 4PDRA 4QIWF 1FD9A 4LR3A 2RMKB 4BR6A 3BRCA 5IYZB 5CMUA 3FX7A 3BCCH 3JCUZ 2GUZB 4W4KA 4UB8Z 4X66O 4TQFA 4DR4B 3K9SA 1JFFB 5BR8O 2DWDC 2Z0AA 5J2UB 3SJCC 1NBMG 3K58A 3DC5A 2V1DA 1NTZH 5IY5B 2PI4A 1KP2A 2CGNA 3U0ZA 2HEPA 1ZX3A 1UJWB 1BCCH 2WLLB 3C3SA 1HW7A 2Q4PA 1KD1W 4ZKIA 3CHXA 2QWPB 1COWG 2HLDG 1KUQA 3HKDA 3H1KH 4AQYO 4FZ1A 2QWQB 4I4TB 2CE4A 3RYHB 1NT2B 3BEHA 1WAZA 4O2AA 3ASNB 4EB6B 5CBHA 1VP7A 4R8CA 3F5TA 3OUFA 4JPRA 1DLBA 3FYEB 1MMMA 4DV4O 3ZHVA 3RYCB 5H2FZ 4FK5C 1N0NA 3CP1A 1R6NA 3K0DA 3K5LA 1WNSA 5IYDO 1BQZA 1EN4A 1PKXA 4TSFG 3SPGA 3H01A 5A2QN 4P2ZA 4TV8A 1Q7YW 2IU3A 2ZNIA 2PGGA 1NH2B 4GYCB 5JCOC 1YWSA 3JSLA 5CA3A 4DUZO 1AI7A 2LGQA 2EBOA 2EILB 4MTFA 2E3CA 3RT3C 3CCSV 3E22A 5JVDA 1OHHG 5B5EZ 4DRXA 2Q67A 2NNUA 3SJAC 5A9GA 2E74B 4U7OA 2JVDA 1H8EG 1JR9A 2IM9A 2QWOB 4ZHQB 4DV7O 1VF6C 3P32A 4HBNA 5EZYB 4DO2A 3ZRVA 3B77A 4FLWA 4PDLA 1EM1A 2XTAA 2EINC 3UT5B 3E2EA 2HJFC 2Z5UA 5LP6C 2B9ZA 4R6ZA 4CS2A 1WPBA 4O2BB 1FKAO 2V4DA 2YI8A 1Y4MA 3EXAA 3T1HB 4DK1A 1N33B 5AG2A 4D4PA 5FPOA 4X1KA 2WLLA 4WBNA 3OGCC 1S76D 3MDSA 3WB0A 4UCVA 4PDVA 3GB7C 1K33A 1RPOA 4JV5B 4YHHB 5EK0A 2JDIG 2BCCH 1SQPH 3OMNB 2ATKC 1WLEA 3JD3A 2QM7A 2E75B 1AJNA 3A8TA 3N2GA 4UCTA 4MVRA 2IJKA 1K7DA 2AZ2A 2ADPA 1HNXO 2YIBD 3BABA 4B3TO 4JYAO 4NXNB 1N32B 4C7UA 5JQGB 2GDSA 4YJ3A 1XMQB 3R65A 4B7EA 2W6JG 4JI3B 4KHPB 4ABMA 1GO3F 1YI2V 1I94B 4I50A 1KU9A 5J2TA 4WFAV 2IJJA 1K4DC 3TXSA 2OYQA 5GW7A 1MZEA 2GTAA 2Q5ZA 2VWJA 3T4ZA 4MT8A 5CBGA 1OCRC 5KLVH 1LUWA 1L1FA 2GSMB 3IAYA 1HP8A 4WFFA 3L70H 1AR4A 4LFBB 4CS3A 2BTOA 2ITCC 2Q7EA 1Y76A 3LNMB 4X1YB 3ZJZA 4WFBV 2ZDIA 4J7JA 4DR4O 1VQNV 3L75H 5KMGA 4P30A 2QJ1A 4UCSA 1IBKO 1YJ9V 4JYCA 1R3IC 2DYRB 2MW2B 1M4UA 1H2KA 2PZSA 1I5YA 2Z3YA 4DR5B 4IHJA 1VQ8V 4X62B 1E1QG 1B06A 2DQ3A 1EBOA 3QO8A 4PI2A 4JZ2A 1KECA 4LF8B 2CUGA 3JARA 3UO3A 2Q7GA 3CB2A 1SESA 5DECA 2AHZA 2BTQA 5LOVA 2HG5C 1FJGB 1H38A 4LFCO 1F4MA 4GX5A 4B3MB 2XAGA 4MW8A 2PYLA 3QO7A 2FYUH 1YIJV 3U10A 3I5DA 2JJ2G 1I08A 4U3JB 1Q43A 3OD4A 3FB8C 2XAJA 4UV8A 1OCZC 2JIZG 1SQXH 3MHHC 4OPHA 4KXRA 3ZBHA 2BSKA 2WA4A 1WA8A 4GCZA 1LR1A 4PA9A 5C93A 2RQ6A 1BE3H 1N4CA 1SZXA 1M1KW 1SETA 4A5UB 1R3LC 4PA4A 1ZL8A 5GONB 1QVGU 4GX0A 1I0HA 2KKWA 2QDOA 2UU9B 1AJQA 3JALB 3BA8A 1XI1A 4I9WA 2QSAA 4ZOLB 3CCRV 4I55B 4NYKA 1VQOV 4BIUA 3E83A 4O4IA 5IJ0A 1Q6HA 1XNQB 3A0RA 2EIMC 3P3PA 5GTHZ 5LGTA 3ML0A 3JD4A 3CCEV 1W0KG 1XILA 2F93B 4GKKO 5GTIZ 2X7RB 5LMUB 3DXRB 1VQ6V 1XNRO 4JI5O 3RYIA 1XDCA 5ITZB 3T1HO 2LQTA 2BE3A 4K0KB 1AR1B 1YCIA 3SYPA 4X88A 1JJOA 1MZFA 4O4LA 2N05A 3ETQA 2Y0IA 5FNVA 1SF9A 3VQXA 5LHHA 3RYFA 3K79A 4JV5O 3SYAA 2CTQA 3CRAA 4EKWA 1FXKB 1ORQC 3M8AA 3BAAA 2YS8A 3ZMZA 4B3RO 3FKSG 4XDLA 3L74H 3AEIA 1BHAA 1R1BA 3IGAC 4LF9O 4NXNO 1K5SA 2Q6AA 4B3SO 1N32O 3CJHA 2P22C 4DV2B 1G6UA 1XMOB 4GKJB 3QO5A 4JI7B 4KHPO 5D5PA 2A3QA 4FLYA 1G8MA 1XHXA 4RUEA 5LP6B 1HNZO 1H2GA 2RCVA 4H33A 1N36B 4QJFB 4RO2A 4TV9A 2ZINA 4KP4A 2IW5A 4DW0A 3H1LH 4FJCC 2YIAA 2JS3A 4GX1A 1TAEA 1JMKC 2HR3A 2WLIA 5KX5B 3SJBC 3TGUH 3FB7C 1ZTEA 3IC9A 3ETGA 3G80A 3ABKB 3BY6A 1M57B 4DV0B 1MSWD 3JCZA 1TUEB 1Z5WA 4AHCA 2JGDB 3SPIA 2ZDIC 2H3OA 2R9AA 2UUAB 4GT1A 3WB2A 1VQ9V 4F6RA 2QKCA 1GN4A 1G4YB 2FB5A 4WFHA 2P5OA 2R9IA 4X62O 1D2DA 4PHZA 1AROP 2YEVB 1VQ7V 3VQWA 1IX9A 1H2MA 2R72A 4P9OA 1WPXA 4MVSA 2K1EA 1IDSA 3ASOC 5CB4B 5JJNB 4WCEV 1PL4A 1NZ6A 3K9AA 1S77D 4NR1A 5JJJB 5HFMA 3T4DA 3LDDA 4O4JA 3E8GA 4N21A 3OTOO 1BSMA 5TISZ 2DJVA 5H9CA 3CCUV 1QVFU 1OCRB 2DYSB 3CWBH 4B3MO 1AP5A 5B1AC 2QR4A 2XAHA 3HKEA 3MHSC 4X20A 5CA0B 1Q82W 4DR6O 1TVKB 1US6A 2Q0AA 5CA1A 2JEUA 1K92A 2CH7B 3FAVB 1RFYA 4JI6B 4DUYO 1FPOA 2AW9A 3AG3B 3E89A 1RM1B 5LMNO 4JI2B 3LSSA 5KUKA 3T1YO 2HFEC 1YTFD 2CDYA 1URFA 2LO1A 3OR6C 3E86A 3LSQA 5IE9A 3K0GA 1HNWB 2OCCB 3Q4HA 1H2LA 2DOSA 4LF5B 1Q5OA 4B08A 4BIOA 1OZ0A 5CBFA 1CXZB 1K3EA 3OW2U 1P7BA 3W7UA 4JASA 3BHPA 3F7VC 3RWRD 3UO2A 5LGNA 1Y74B 1GM8A 5IJ9B 3UQ8A 1Q6UA 3A0BZ 2JS5A 2P06A 3AG1C 1AVMA 4JI4O 4JZGA 4K3AA 5B66Z 1WB8A 3AG2C 3ABTA 4X1IA 1AJPA 4O4HA 3B40A 5LXTA 1QLNA 3OUSA 3OAAG 3N2KB 4JI1B 1S5LZ 2H94A 5KA6A 3ZMTA 2ZR3A 4NKGB 4I0XB 1NKDA 3UM7A 3ZEDA 2ZCEA 1Q6IA 2KG7A 5KHKA 3RFRA 5EBMC 4EFBA 1RPRA 4FIPC 2V7QG 3PJSK 3K5MA 2Q9LA
chains in the Genus database with same CATH topology
1N4CA 3UCSC 2Y4TA 3AG7A 1WJZA 1BQ0A 2L6LA 2LO1A 2PF4E 2N04A 2OCHA 3APOA 2QWRB 3BVOA 2DN9A 1YOPA 3UO2A 2CUGA 1YWSA 4J7ZA 4D4PA 4IT5A 3UO3A 4D4OA 1FPOA 2JR7A 1IURA 2CTQA 2EJ7A 4J80A 5AX2A 4X33A 2GUZB 2CTWA 2QWPB 2QSAA 2YS8A 1XBLA 2CTRA 2Y4UA 4RWUA 2YUAA 3APQA 1BQZA 1WGEA 1HDJA 2QWQB 2M6YA 2QWNB 2DMXA 1GH6A 2CTPA 2LGWA 2GUZA 2KQXA 1FAFA 1NZ6A 2QWOB 2N05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4C A;  3UCS C;  2Y4T A;  3AG7 A;  1WJZ A;  1BQ0 A;  2L6L A;  2LO1 A;  2PF4 E;  2N04 A;  2OCH A;  3APO A;  2QWR B;  3BVO A;  2DN9 A;  1YOP A;  3UO2 A;  2CUG A;  1YWS A;  4J7Z A;  4D4P A;  4IT5 A;  3UO3 A;  4D4O A;  1FPO A;  2JR7 A;  1IUR A;  2CTQ A;  2EJ7 A;  4J80 A;  5AX2 A;  4X33 A;  2GUZ B;  2CTW A;  2QWP B;  2QSA A;  2YS8 A;  1XBL A;  2CTR A;  2Y4U A;  4RWU A;  2YUA A;  3APQ A;  1BQZ A;  1WGE A;  1HDJ A;  2QWQ B;  2M6Y A;  2QWN B;  2DMX A;  1GH6 A;  2CTP A;  2LGW A;  2GUZ A;  2KQX A;  1FAF A;  1NZ6 A;  2QWO B;  2N05 A; 
#chains in the Genus database with same CATH topology
 4MSW C;  4JTC B;  3IC7 A;  4HNA A;  1QLE B;  3GVM A;  4LFA O;  3B8M A;  4BWA A;  2JEX A;  5EIB C;  3CCM V;  1V55 C;  2YID A;  4FFB A;  4R50 A;  3S3W A;  5EYP B;  4YIO A;  4DR2 B;  4L87 A;  3WG7 C;  4OX9 O;  4MVU A;  1GRJ A;  4WFE A;  2EZO A;  3TET A;  2ZXW B;  3OT7 A;  4YIP A;  3RGB A;  2UUA O;  3AG4 B;  3SR2 C;  3LSU A;  4L8J A;  1TA8 A;  2ZD9 A;  3THO A;  3CCL V;  1YIT V;  4X64 B;  1CP9 A;  2VQE B;  4G27 B;  1XL4 A;  4LF4 B;  1YDX A;  4Z1M G;  5K1X A;  4DV3 O;  4BIZ A;  4IYI A;  3ZRW A;  4I5S A;  3OFN G;  4YJ2 B;  2MK3 A;  5IWA O;  1O9G A;  2EJ7 A;  1MNG A;  3E8F A;  5KUM A;  1FFX A;  3QNE A;  4JI0 B;  5KAF Z;  2ZR2 A;  1VIB A;  4UUJ C;  2UXD O;  4DV5 O;  1KKD A;  1W0J G;  5KHI A;  3LDE A;  4DV1 O;  4JTD B;  1S5J A;  3CC7 V;  4UVB A;  4TUY B;  4I7Z B;  3G6B A;  2GTS A;  3ABL C;  3OGI B;  2ZM6 O;  3HKB B;  5IYZ A;  1N34 O;  1H8H G;  5JH7 B;  1KYO F;  2F43 G;  2WLM A;  3O9O A;  3M99 B;  1ROP A;  4JI6 O;  2E5L B;  2GUZ A;  4CH6 A;  1FFT B;  4OXS A;  1M56 C;  4NVP A;  2CGO A;  3VOU A;  1ZAU A;  2AZ0 A;  1JFF A;  4H0L B;  1XL6 A;  5J2U A;  3H9V A;  2L35 A;  3HKC B;  1VF7 A;  4FLX A;  1V54 B;  2WLH A;  2F23 A;  4LF7 B;  3K5N A;  3SPH A;  4LF6 B;  3CRM A;  4UVA A;  2GHY A;  4CC6 A;  5LBQ A;  4X9Q A;  5EBW C;  4ZI7 B;  4FM1 A;  2EJR A;  2WA3 A;  1F7Y A;  1HNW O;  2JGU A;  4LF5 O;  2G38 A;  4I4T A;  3RYH A;  2ZE7 A;  4DV6 B;  4EB6 A;  2UXC O;  2R9R B;  1P7G A;  5L3C A;  2CK3 G;  1R6K A;  1N8R W;  3L9D A;  3RYC A;  3FYI B;  4JI8 O;  4R7C A;  3ZS8 C;  3STZ C;  3H1J H;  3CD6 V;  3KCY A;  3WFV A;  1R3J C;  2YDE A;  4BAY A;  4IIJ B;  1YXB A;  3CRC A;  1EN5 A;  4G28 B;  4RQE A;  3K57 A;  2JJ1 G;  1XOU A;  4JI1 O;  3S3X A;  2PYJ A;  1WGE A;  2B1I A;  4LWS B;  2EIK B;  4X8A A;  2X6C A;  3FB5 C;  1Z5V A;  3QTC A;  1YOP A;  2P67 A;  4ZHQ A;  1QQC A;  5EZY A;  3ZN0 A;  1JCH A;  5B1N A;  4JGS A;  4QNH B;  1AP6 A;  4DR3 B;  3UT5 A;  4CC5 A;  2X6B A;  1SRY A;  2ZE5 A;  3DC6 A;  2ZE8 A;  2QM8 A;  4IGG A;  4O2B A;  3L73 H;  2IU0 A;  1VQ5 V;  4Q6G A;  3B09 A;  1FS0 G;  4FM2 A;  3BFR A;  3AG2 B;  2IJI A;  1PM9 A;  1L8D A;  2XND G;  2UUB B;  5EIB D;  3ZHQ A;  3N27 A;  1EN6 A;  2WLK A;  4X89 A;  2QWR B;  4JYB A;  4FLZ A;  5IDJ A;  1VQ4 V;  5IYB O;  4LF4 O;  5JJE B;  4K8Z A;  1D5N A;  3OE7 G;  3JYC A;  5BMV B;  5BY1 A;  1RSO B;  2UUC B;  1HR0 B;  2NR5 A;  2QKS A;  5JQG A;  2DE0 X;  1WJZ A;  1V9P A;  1OCO C;  2QM4 A;  1R3K C;  2BOC C;  3APO A;  3JAS B;  1JOY A;  1GN3 A;  3D3I A;  3SJQ C;  1I5X A;  2JR7 A;  2KSD A;  4DYL A;  2EIJ C;  4J11 A;  4LC1 A;  3K08 A;  1IXM A;  2YSU B;  5LGU A;  1GH6 A;  3CRR A;  2HVJ C;  1QR9 A;  4GX2 A;  2Y69 C;  1AB3 A;  1VAR A;  4PV1 B;  2YIB A;  3K04 A;  1NS1 A;  1K4C C;  5KAI Z;  2VQF B;  3VBB A;  1K5Q A;  4LNU B;  5LL6 Y;  1DF5 A;  4MVO A;  2PTM A;  4X1Y A;  2CAZ C;  3G6E V;  1SA0 B;  1GN2 A;  3CCV V;  1N33 O;  2DW4 A;  1O9H A;  1H2S B;  3UCS C;  1IBL B;  1HWY A;  1ZUQ A;  4Q20 A;  4RUF A;  1KB9 F;  2ZIM A;  1PPJ H;  3LNN A;  3FB6 C;  3IJ4 A;  4CZZ A;  4GLX A;  4DR1 B;  4YHH O;  3CYO A;  2HJD A;  2LP7 A;  1WP8 A;  1DK1 A;  3RVZ A;  3K3W A;  4DV6 O;  5KA5 A;  3W7X A;  4HAM A;  1OJH A;  5EC1 C;  1PL0 A;  1L0L H;  5LA6 B;  4UXN A;  2W6I G;  3ASN C;  1XMQ O;  2EIN B;  2JK5 C;  4YXW G;  4JI3 O;  1QBZ A;  5IT9 N;  3BPZ A;  1I94 O;  4CH4 A;  3TJT A;  4DK0 A;  1J5E B;  4UCR A;  1LUV A;  2W0X A;  4U3J A;  4ZBM A;  1YSC A;  1Z2G A;  4IL6 Z;  3LDC A;  4FLT A;  2ZKO A;  2D3O W;  3MD0 A;  4XDK A;  3RVY A;  5FPR A;  1OV9 A;  1Y66 A;  4NTX A;  5BR8 B;  2VWK A;  3JAK B;  5BXZ A;  4F6E A;  4GUN A;  2XAS A;  1KKC A;  3KKY A;  4PA6 A;  4LFB O;  3E8H A;  2B1G A;  3JD1 A;  5L3G A;  1JX9 A;  2EIL C;  3J80 N;  2YC0 A;  5GON A;  2N74 A;  2DQ0 A;  3CEI A;  3PN1 A;  1GK9 A;  3JAL A;  3K59 A;  4UVC A;  1K8A W;  2RJZ A;  4ZOL A;  3K5O A;  2OTJ V;  4I55 A;  3ZMV A;  4TWK A;  1F51 A;  4AQY B;  2HHH B;  4DR5 O;  1PNK A;  1F4N A;  5C8Y B;  3WU2 Z;  1M9N A;  3DXR A;  2LGW A;  4LF8 O;  5KHJ A;  5ITZ A;  5LYJ B;  1Q90 D;  1Y67 A;  5LHG A;  1FJG O;  2KB1 A;  2UUB O;  2IJH A;  1DGS A;  2WLN A;  1S0V A;  1HDJ A;  4FVM A;  4DUZ B;  3JAT B;  2F1M A;  1FXK A;  1QCE A;  4WFG A;  1QNM A;  2OTL V;  3VQY A;  1IVS A;  1W59 A;  5B1B C;  2UUC O;  3G4S V;  2E76 B;  2PUS A;  4DV7 B;  4NXM B;  5DM6 V;  2Q73 A;  3D36 A;  2H8P C;  4PDM A;  3ICX A;  2UU9 O;  2FL4 A;  4AI8 A;  5LP6 A;  2QTO A;  1Q86 W;  3HB3 B;  1ZWI C;  1FYJ A;  3STL C;  2QGN A;  2ILM A;  3SPJ A;  2Q8V A;  3HKD B;  1S72 V;  3U11 A;  1BGY H;  5L3E A;  2LJ2 A;  1KP3 A;  1XNQ O;  5KX5 A;  3J81 N;  1BS3 A;  4O2A B;  3ABU A;  2DMX A;  3K03 A;  4H13 B;  1CEZ A;  4MTX A;  5BZB A;  5LMU O;  3KZI Z;  1NU1 H;  3I56 V;  2JGD A;  3O65 A;  3SPC A;  1D5A A;  1NTM H;  4Z1V A;  1IBM B;  3SYC A;  2QEX V;  1YTF B;  4K0K O;  1XUQ A;  4WF9 V;  1OCZ B;  3D3Q A;  4DR7 B;  4MW3 A;  1YJW V;  2WWW A;  3ZIA G;  4TV8 B;  2DYR C;  1YVW A;  2M6Y A;  2ODM A;  4PI0 A;  1B6Q A;  1GAX A;  2YEV A;  3EVK A;  4B3T B;  1Q81 W;  4JYA B;  4PA7 A;  2P6J A;  1R73 A;  1CPY A;  2FKX A;  1P84 F;  5CB4 A;  1M93 A;  1AIL A;  5LYJ A;  3E22 B;  1PNM A;  5JVD B;  4DRX B;  3RN4 A;  4CH5 A;  2QA4 V;  1JJ2 U;  1SQV H;  1NJI W;  2ARH A;  4DV2 O;  1XMO O;  4GKJ O;  4JI7 O;  5H6Q A;  5B3S C;  2EIM B;  2OIG A;  4LBE C;  4EFE A;  1J5E O;  1YJN V;  3JAT A;  5CA0 A;  3G71 V;  1TVK A;  5FL7 G;  1N36 O;  1XHZ A;  2NLJ C;  2C2A A;  4YY3 B;  2ZQM A;  4J10 A;  2CH7 A;  2ZT9 B;  3FAV A;  3T1C A;  4JAU A;  4BW9 A;  4UV9 A;  1VQK V;  2YXL A;  3ZHU A;  1DTO A;  1IBK B;  4FLV A;  3ZRX A;  4DV0 O;  3UKM A;  1GTO A;  4X1K B;  4WBN B;  1VQL V;  4IT5 A;  4RAI A;  4FM0 A;  1PD3 A;  1JQ0 A;  2XOK G;  4D7S A;  4PA3 A;  1NH2 D;  3N2G B;  3QVN A;  4ZIB A;  2HHH O;  3BA9 A;  2KQX A;  1B3Q A;  3J7A U;  4FPP A;  2WLJ A;  2X6A A;  1X59 A;  1T5E A;  3ETD A;  3AG7 A;  1RP3 B;  2XAF A;  2YIC A;  4I9Q A;  4JAA A;  4YJ3 B;  2HVK C;  5LHI A;  1X4T A;  4LFC B;  2WAM A;  1E1R G;  4D6T H;  4I50 B;  4Z2W A;  3I55 V;  5J2T B;  4RWU A;  3APQ A;  1Y74 A;  3MAQ A;  3X2Q C;  5IJ9 A;  1MA1 A;  3L72 H;  4JAV A;  1AI5 A;  4CH3 A;  4U3F H;  3ZHT A;  3E8B A;  1BQ0 A;  1GMG A;  2A79 B;  3CXH F;  1ZSP A;  1NVP D;  4J9Z B;  4D7T A;  1YHQ V;  1NR7 A;  1WN7 A;  3N2K A;  1TGO A;  3SYO A;  2GBO A;  1FXK C;  2QTS A;  2A0L A;  1Q3E A;  4AIL C;  1Y76 B;  4I0X A;  3CX5 F;  2OT5 A;  3FFQ A;  5DED A;  5KMG B;  2A06 H;  1FAF A;  1G1X B;  4G2K A;  2AGA A;  4DXW A;  4NXM O;  4JI2 O;  5K1P A;  4N23 A;  4K8X A;  2LW7 A;  3CC4 V;  1OCC C;  3D36 C;  4J7K A;  1KQS U;  4IHJ B;  1NVP B;  2LFS A;  2HKO A;  1ENV A;  2UXN A;  3ZMU A;  2CTR A;  3ASO B;  1QU7 A;  4K35 A;  3ZN1 A;  4GKK B;  1SKV A;  4UB6 Z;  1XNR B;  4JI5 B;  1MSD A;  3JAR B;  5EYP A;  1GKF A;  3HR0 A;  5E79 Z;  1VF5 B;  2LFR A;  4HZ3 A;  3C90 A;  2BTQ B;  4J7Z A;  5LOV B;  1WB7 A;  3HPL C;  5B1A B;  3ABK C;  1IBM O;  4TQD A;  1BMF G;  1M57 C;  2Q69 A;  1YEW A;  1M5I A;  2M7W A;  4CBC A;  1BL8 A;  3R66 A;  3OR7 C;  4DR7 O;  2RN9 A;  5B1B B;  3ZCC A;  3ABM C;  5EBL C;  3CRQ A;  4B3R B;  2XHB A;  4E2L A;  4QGP A;  1K34 A;  2BSK B;  1WA8 B;  4LF9 B;  4B3S B;  2Q0O C;  4LH6 A;  4YJ2 A;  3CSX A;  1ZL8 B;  4MTG A;  1VMG A;  2ZNJ A;  1AI4 A;  5KHG A;  4QPK A;  4OPA A;  3P30 A;  2VRZ A;  1HNZ B;  3E35 A;  5JWP A;  1AI6 A;  2F4V B;  4JF3 A;  1R6T A;  1MAB G;  3OTF A;  2BOB C;  1IUR A;  5B1O A;  2FTK A;  2EZP A;  3W7T A;  4O4I B;  3L71 H;  5IJ0 B;  5H5N A;  3CCQ V;  4TUY A;  2DYS C;  3LUT B;  1XBL A;  3GWO A;  3ZRS A;  2ZIO A;  3DGE A;  4YY3 O;  4CS4 A;  1XRE A;  3DSQ A;  1GN6 A;  3HKB A;  1Q8I A;  1KMI Z;  5JH7 A;  4FFK A;  1NTK H;  2PF4 E;  3RYI B;  3JAW B;  3KCX A;  2YI9 A;  4DR2 O;  5L3B A;  4PD4 F;  3AK1 A;  3AG1 B;  3AG3 C;  1RM1 C;  4NB5 A;  4O4L B;  2R70 A;  3B2E E;  1XEQ A;  3HKC A;  4NTW A;  2Y4U A;  3OMA B;  2YUA A;  5FNV B;  3WB1 A;  2OWO A;  2WPD G;  2XT9 A;  1PV0 A;  3AK3 A;  1SQB H;  3RYF B;  4PEL A;  5H6R A;  2VS0 A;  4ZI7 A;  3JSN A;  4NTY A;  5IYC O;  2A9H A;  4X64 O;  2YXH A;  5FLX N;  3ZMS A;  2VQE O;  5AX2 A;  1NQT A;  1UFI A;  3FD9 A;  3W7S A;  4RQF A;  2OCC C;  3RBZ A;  5B3S B;  2X0L A;  3OTO B;  3CJH B;  2AXT Z;  3DTU B;  1J95 A;  4IYH A;  1K73 W;  2HP8 A;  4P9P A;  2FML A;  4JI0 O;  1A32 A;  4DR6 B;  3B8N A;  1V55 B;  3CMA V;  4TV9 B;  3OM3 B;  3EHB B;  2P7T C;  1K9M W;  4IIJ A;  3OEE G;  3WG7 B;  2ETN A;  3W7W A;  1K97 A;  2YXY A;  1JPX A;  2XAQ A;  1THZ A;  2EX3 A;  4DUY B;  1VQP V;  2WLI B;  1EZV H;  5LMN B;  1FXH A;  1NI8 A;  4JYY A;  4EEQ A;  4OGQ B;  1TUB B;  3NR7 A;  4LWS A;  4MVZ A;  3T1Y B;  2DN9 A;  4DW1 A;  1SQF A;  4ICG A;  2E5L O;  2K9P A;  2AHY A;  4J80 A;  1PP9 H;  4H37 A;  2OIE A;  1WP7 A;  5J9P C;  2NN4 A;  4F6R B;  2CTP A;  2LW1 A;  4HYO A;  3D8C A;  3H1H H;  3TK1 A;  4LF7 O;  5IY5 C;  1S3J A;  4LF6 O;  2RNB A;  3TXQ A;  2UXB B;  4X65 B;  2O57 A;  1QLE C;  4MTO A;  5L3D A;  3CPW U;  4QE9 A;  4X33 A;  1QHT A;  3JAW A;  3X2Q B;  1IZ3 A;  4U7N A;  1KBH A;  3T2M A;  1S5H C;  4J42 A;  1KC8 W;  4O4J B;  1B04 A;  1W2B U;  3ZX6 A;  2F66 C;  2P90 A;  4JI4 B;  3H1I H;  3HKE B;  2ADQ B;  2ZXW C;  3QF7 A;  1SZT A;  3SDL A;  3ABL B;  4X20 B;  3AG4 C;  3SYQ A;  5CA1 B;  3CS5 A;  5EC2 C;  3G67 A;  1M56 B;  2ZE6 A;  3CXC U;  1VQM V;  5BMV A;  1RSO A;  4MVQ A;  4JTA B;  4X66 B;  1OCC B;  3NXS A;  4PJ0 Z;  4MS2 A;  2UXX A;  1Y6X A;  4D4O A;  4XDJ A;  2P4K A;  2QE7 G;  4MVM A;  1MG1 A;  2A7W A;  3JAS A;  2F4V O;  2IH3 C;  4LFA B;  1GM9 A;  1SQG A;  1P4R A;  3B4S A;  2Y4T A;  1SER A;  4TOI A;  3F5W C;  1FXV A;  3Q4H B;  2OCH A;  4DR3 O;  2F95 B;  2PI5 A;  4OX9 B;  4W4L A;  1IXB A;  1TUB A;  3JD0 A;  4TT3 G;  1EZJ A;  2QKA A;  4QE7 A;  4LNU A;  3A0H Z;  4E4E A;  3GWK C;  2JRI A;  3K06 A;  4J9Y B;  4DV4 B;  1SA0 A;  3QG5 A;  3ABM B;  2Q68 A;  4BW5 A;  1VEW A;  1F23 A;  2EUL A;  3BVO A;  3SGI A;  4FMT A;  3IFX A;  2W0F C;  4X1I B;  4O4H B;  5JCO A;  4DV3 B;  2WSS G;  1V54 C;  1L0N H;  5LXT B;  3F7Y C;  2XUM A;  1I7F A;  1SC5 B;  5KHH A;  3KG2 A;  1AR5 A;  5IWA B;  1BT8 A;  1UPG A;  5E1A C;  1N0J A;  3A2F A;  1E79 G;  3ZHS A;  3JAM N;  1P49 A;  4LP8 A;  2KG7 B;  4XBF A;  1VF6 A;  1HR0 O;  1XQ8 A;  2UXD B;  4DV5 B;  3P3N A;  1QR8 A;  2DWE C;  4FLU A;  5LA6 A;  4GZR B;  4DV1 B;  1BZK A;  4UFZ A;  1NR1 A;  1MOF A;  3TCU A;  2QWN B;  4LH7 A;  3CC2 V;  4HNA B;  5HFL A;  4ASU G;  1U97 A;  4FZ0 A;  2ZM6 B;  5DN6 G;  1N34 B;  5CN0 A;  2GV9 A;  4FFB B;  4QPJ A;  2Y48 A;  2RDC A;  2IH1 C;  3OMI B;  4UCU A;  4H44 B;  1YF2 A;  4F4L A;  5L3F A;  1U96 A;  3JAK A;  3OEH G;  3EFF K;  2VQF O;  2Y0P A;  1ZLZ A;  3M7M X;  1SS3 A;  2EIK C;  3JD2 A;  2P4V A;  2B5U A;  3AK2 A;  2D2C B;  2N04 A;  3ETE A;  3CME V;  1PNL A;  1IBL O;  2PY5 A;  1BHB A;  2IBZ H;  3C3T A;  2UXB O;  4X65 O;  1EFR G;  3ZRW B;  1JA8 A;  3CE2 A;  2UXC B;  4DR1 O;  1HNX B;  5C8Y A;  3VQV A;  4KFM A;  1OCO B;  4KL1 A;  4LCU C;  2L6L A;  5D5Q A;  1DF4 A;  1JVM A;  1FFX B;  4JI8 B;  1H2N A;  4J41 A;  1LNQ A;  5F2V O;  4B7K A;  2ITD C;  2EIJ B;  1M90 W;  4UCO A;  2CTW A;  2Q7H A;  4KUM A;  1SQQ H;  1YZB A;  3CCJ V;  1GM7 A;  3ZHR A;  3RW0 A;  2Y69 B;  4PDR A;  4QIW F;  1FD9 A;  4LR3 A;  2RMK B;  4BR6 A;  3BRC A;  5IYZ B;  5CMU A;  3FX7 A;  3BCC H;  3JCU Z;  2GUZ B;  4W4K A;  4UB8 Z;  4X66 O;  4TQF A;  4DR4 B;  3K9S A;  1JFF B;  5BR8 O;  2DWD C;  2Z0A A;  5J2U B;  3SJC C;  1NBM G;  3K58 A;  3DC5 A;  2V1D A;  1NTZ H;  5IY5 B;  2PI4 A;  1KP2 A;  2CGN A;  3U0Z A;  2HEP A;  1ZX3 A;  1UJW B;  1BCC H;  2WLL B;  3C3S A;  1HW7 A;  2Q4P A;  1KD1 W;  4ZKI A;  3CHX A;  2QWP B;  1COW G;  2HLD G;  1KUQ A;  3HKD A;  3H1K H;  4AQY O;  4FZ1 A;  2QWQ B;  4I4T B;  2CE4 A;  3RYH B;  1NT2 B;  3BEH A;  1WAZ A;  4O2A A;  3ASN B;  4EB6 B;  5CBH A;  1VP7 A;  4R8C A;  3F5T A;  3OUF A;  4JPR A;  1DLB A;  3FYE B;  1MMM A;  4DV4 O;  3ZHV A;  3RYC B;  5H2F Z;  4FK5 C;  1N0N A;  3CP1 A;  1R6N A;  3K0D A;  3K5L A;  1WNS A;  5IYD O;  1BQZ A;  1EN4 A;  1PKX A;  4TSF G;  3SPG A;  3H01 A;  5A2Q N;  4P2Z A;  4TV8 A;  1Q7Y W;  2IU3 A;  2ZNI A;  2PGG A;  1NH2 B;  4GYC B;  5JCO C;  1YWS A;  3JSL A;  5CA3 A;  4DUZ O;  1AI7 A;  2LGQ A;  2EBO A;  2EIL B;  4MTF A;  2E3C A;  3RT3 C;  3CCS V;  3E22 A;  5JVD A;  1OHH G;  5B5E Z;  4DRX A;  2Q67 A;  2NNU A;  3SJA C;  5A9G A;  2E74 B;  4U7O A;  2JVD A;  1H8E G;  1JR9 A;  2IM9 A;  2QWO B;  4ZHQ B;  4DV7 O;  1VF6 C;  3P32 A;  4HBN A;  5EZY B;  4DO2 A;  3ZRV A;  3B77 A;  4FLW A;  4PDL A;  1EM1 A;  2XTA A;  2EIN C;  3UT5 B;  3E2E A;  2HJF C;  2Z5U A;  5LP6 C;  2B9Z A;  4R6Z A;  4CS2 A;  1WPB A;  4O2B B;  1FKA O;  2V4D A;  2YI8 A;  1Y4M A;  3EXA A;  3T1H B;  4DK1 A;  1N33 B;  5AG2 A;  4D4P A;  5FPO A;  4X1K A;  2WLL A;  4WBN A;  3OGC C;  1S76 D;  3MDS A;  3WB0 A;  4UCV A;  4PDV A;  3GB7 C;  1K33 A;  1RPO A;  4JV5 B;  4YHH B;  5EK0 A;  2JDI G;  2BCC H;  1SQP H;  3OMN B;  2ATK C;  1WLE A;  3JD3 A;  2QM7 A;  2E75 B;  1AJN A;  3A8T A;  3N2G A;  4UCT A;  4MVR A;  2IJK A;  1K7D A;  2AZ2 A;  2ADP A;  1HNX O;  2YIB D;  3BAB A;  4B3T O;  4JYA O;  4NXN B;  1N32 B;  4C7U A;  5JQG B;  2GDS A;  4YJ3 A;  1XMQ B;  3R65 A;  4B7E A;  2W6J G;  4JI3 B;  4KHP B;  4ABM A;  1GO3 F;  1YI2 V;  1I94 B;  4I50 A;  1KU9 A;  5J2T A;  4WFA V;  2IJJ A;  1K4D C;  3TXS A;  2OYQ A;  5GW7 A;  1MZE A;  2GTA A;  2Q5Z A;  2VWJ A;  3T4Z A;  4MT8 A;  5CBG A;  1OCR C;  5KLV H;  1LUW A;  1L1F A;  2GSM B;  3IAY A;  1HP8 A;  4WFF A;  3L70 H;  1AR4 A;  4LFB B;  4CS3 A;  2BTO A;  2ITC C;  2Q7E A;  1Y76 A;  3LNM B;  4X1Y B;  3ZJZ A;  4WFB V;  2ZDI A;  4J7J A;  4DR4 O;  1VQN V;  3L75 H;  5KMG A;  4P30 A;  2QJ1 A;  4UCS A;  1IBK O;  1YJ9 V;  4JYC A;  1R3I C;  2DYR B;  2MW2 B;  1M4U A;  1H2K A;  2PZS A;  1I5Y A;  2Z3Y A;  4DR5 B;  4IHJ A;  1VQ8 V;  4X62 B;  1E1Q G;  1B06 A;  2DQ3 A;  1EBO A;  3QO8 A;  4PI2 A;  4JZ2 A;  1KEC A;  4LF8 B;  2CUG A;  3JAR A;  3UO3 A;  2Q7G A;  3CB2 A;  1SES A;  5DEC A;  2AHZ A;  2BTQ A;  5LOV A;  2HG5 C;  1FJG B;  1H38 A;  4LFC O;  1F4M A;  4GX5 A;  4B3M B;  2XAG A;  4MW8 A;  2PYL A;  3QO7 A;  2FYU H;  1YIJ V;  3U10 A;  3I5D A;  2JJ2 G;  1I08 A;  4U3J B;  1Q43 A;  3OD4 A;  3FB8 C;  2XAJ A;  4UV8 A;  1OCZ C;  2JIZ G;  1SQX H;  3MHH C;  4OPH A;  4KXR A;  3ZBH A;  2BSK A;  2WA4 A;  1WA8 A;  4GCZ A;  1LR1 A;  4PA9 A;  5C93 A;  2RQ6 A;  1BE3 H;  1N4C A;  1SZX A;  1M1K W;  1SET A;  4A5U B;  1R3L C;  4PA4 A;  1ZL8 A;  5GON B;  1QVG U;  4GX0 A;  1I0H A;  2KKW A;  2QDO A;  2UU9 B;  1AJQ A;  3JAL B;  3BA8 A;  1XI1 A;  4I9W A;  2QSA A;  4ZOL B;  3CCR V;  4I55 B;  4NYK A;  1VQO V;  4BIU A;  3E83 A;  4O4I A;  5IJ0 A;  1Q6H A;  1XNQ B;  3A0R A;  2EIM C;  3P3P A;  5GTH Z;  5LGT A;  3ML0 A;  3JD4 A;  3CCE V;  1W0K G;  1XIL A;  2F93 B;  4GKK O;  5GTI Z;  2X7R B;  5LMU B;  3DXR B;  1VQ6 V;  1XNR O;  4JI5 O;  3RYI A;  1XDC A;  5ITZ B;  3T1H O;  2LQT A;  2BE3 A;  4K0K B;  1AR1 B;  1YCI A;  3SYP A;  4X88 A;  1JJO A;  1MZF A;  4O4L A;  2N05 A;  3ETQ A;  2Y0I A;  5FNV A;  1SF9 A;  3VQX A;  5LHH A;  3RYF A;  3K79 A;  4JV5 O;  3SYA A;  2CTQ A;  3CRA A;  4EKW A;  1FXK B;  1ORQ C;  3M8A A;  3BAA A;  2YS8 A;  3ZMZ A;  4B3R O;  3FKS G;  4XDL A;  3L74 H;  3AEI A;  1BHA A;  1R1B A;  3IGA C;  4LF9 O;  4NXN O;  1K5S A;  2Q6A A;  4B3S O;  1N32 O;  3CJH A;  2P22 C;  4DV2 B;  1G6U A;  1XMO B;  4GKJ B;  3QO5 A;  4JI7 B;  4KHP O;  5D5P A;  2A3Q A;  4FLY A;  1G8M A;  1XHX A;  4RUE A;  5LP6 B;  1HNZ O;  1H2G A;  2RCV A;  4H33 A;  1N36 B;  4QJF B;  4RO2 A;  4TV9 A;  2ZIN A;  4KP4 A;  2IW5 A;  4DW0 A;  3H1L H;  4FJC C;  2YIA A;  2JS3 A;  4GX1 A;  1TAE A;  1JMK C;  2HR3 A;  2WLI A;  5KX5 B;  3SJB C;  3TGU H;  3FB7 C;  1ZTE A;  3IC9 A;  3ETG A;  3G80 A;  3ABK B;  3BY6 A;  1M57 B;  4DV0 B;  1MSW D;  3JCZ A;  1TUE B;  1Z5W A;  4AHC A;  2JGD B;  3SPI A;  2ZDI C;  2H3O A;  2R9A A;  2UUA B;  4GT1 A;  3WB2 A;  1VQ9 V;  4F6R A;  2QKC A;  1GN4 A;  1G4Y B;  2FB5 A;  4WFH A;  2P5O A;  2R9I A;  4X62 O;  1D2D A;  4PHZ A;  1ARO P;  2YEV B;  1VQ7 V;  3VQW A;  1IX9 A;  1H2M A;  2R72 A;  4P9O A;  1WPX A;  4MVS A;  2K1E A;  1IDS A;  3ASO C;  5CB4 B;  5JJN B;  4WCE V;  1PL4 A;  1NZ6 A;  3K9A A;  1S77 D;  4NR1 A;  5JJJ B;  5HFM A;  3T4D A;  3LDD A;  4O4J A;  3E8G A;  4N21 A;  3OTO O;  1BSM A;  5TIS Z;  2DJV A;  5H9C A;  3CCU V;  1QVF U;  1OCR B;  2DYS B;  3CWB H;  4B3M O;  1AP5 A;  5B1A C;  2QR4 A;  2XAH A;  3HKE A;  3MHS C;  4X20 A;  5CA0 B;  1Q82 W;  4DR6 O;  1TVK B;  1US6 A;  2Q0A A;  5CA1 A;  2JEU A;  1K92 A;  2CH7 B;  3FAV B;  1RFY A;  4JI6 B;  4DUY O;  1FPO A;  2AW9 A;  3AG3 B;  3E89 A;  1RM1 B;  5LMN O;  4JI2 B;  3LSS A;  5KUK A;  3T1Y O;  2HFE C;  1YTF D;  2CDY A;  1URF A;  2LO1 A;  3OR6 C;  3E86 A;  3LSQ A;  5IE9 A;  3K0G A;  1HNW B;  2OCC B;  3Q4H A;  1H2L A;  2DOS A;  4LF5 B;  1Q5O A;  4B08 A;  4BIO A;  1OZ0 A;  5CBF A;  1CXZ B;  1K3E A;  3OW2 U;  1P7B A;  3W7U A;  4JAS A;  3BHP A;  3F7V C;  3RWR D;  3UO2 A;  5LGN A;  1Y74 B;  1GM8 A;  5IJ9 B;  3UQ8 A;  1Q6U A;  3A0B Z;  2JS5 A;  2P06 A;  3AG1 C;  1AVM A;  4JI4 O;  4JZG A;  4K3A A;  5B66 Z;  1WB8 A;  3AG2 C;  3ABT A;  4X1I A;  1AJP A;  4O4H A;  3B40 A;  5LXT A;  1QLN A;  3OUS A;  3OAA G;  3N2K B;  4JI1 B;  1S5L Z;  2H94 A;  5KA6 A;  3ZMT A;  2ZR3 A;  4NKG B;  4I0X B;  1NKD A;  3UM7 A;  3ZED A;  2ZCE A;  1Q6I A;  2KG7 A;  5KHK A;  3RFR A;  5EBM C;  4EFB A;  1RPR A;  4FIP C;  2V7Q G;  3PJS K;  3K5M A;  2Q9L A; 
#chains in the Genus database with same CATH homology
 1N4C A;  3UCS C;  2Y4T A;  3AG7 A;  1WJZ A;  1BQ0 A;  2L6L A;  2LO1 A;  2PF4 E;  2N04 A;  2OCH A;  3APO A;  2QWR B;  3BVO A;  2DN9 A;  1YOP A;  3UO2 A;  2CUG A;  1YWS A;  4J7Z A;  4D4P A;  4IT5 A;  3UO3 A;  4D4O A;  1FPO A;  2JR7 A;  1IUR A;  2CTQ A;  2EJ7 A;  4J80 A;  5AX2 A;  4X33 A;  2GUZ B;  2CTW A;  2QWP B;  2QSA A;  2YS8 A;  1XBL A;  2CTR A;  2Y4U A;  4RWU A;  2YUA A;  3APQ A;  1BQZ A;  1WGE A;  1HDJ A;  2QWQ B;  2M6Y A;  2QWN B;  2DMX A;  1GH6 A;  2CTP A;  2LGW A;  2GUZ A;  2KQX A;  1FAF A;  1NZ6 A;  2QWO B;  2N05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...