2L6LA

Solution structure of human j-protein co-chaperone, dph4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human J-protein cochaperone Dph4
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily C member 24
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF05207 zf-CSL CSL zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2l6lA01
3.10.660.10 Alpha Beta Roll Microbial ribonuclease fold DPH Zinc finger 2l6lA02
2YUAA 2L6LA 4X33A 1XBLA 1WJZA 2QWOB 1BQZA 2CTWA 2OCHA 2M6YA 1WGEA 2DMXA 4J7ZA 2LGWA 2JR7A 2CTRA 2QWNB 1N4CA 3AG7A 3APOA 1IURA 5AX2A 4IT5A 2CUGA 2GUZA 4D4PA 3UO2A 1YOPA 1YWSA 2GUZB 2QSAA 2N05A 2DN9A 2Y4TA 1FAFA 3UCSC 2N04A 3BVOA 1BQ0A 2QWPB 2CTQA 1FPOA 4RWUA 2PF4E 2YS8A 3UO3A 1GH6A 2CTPA 2KQXA 4D4OA 1NZ6A 2QWRB 4J80A 3APQA 2QWQB 1HDJA 2LO1A 2Y4UA 2EJ7A
chains in the Genus database with same CATH superfamily
1ZWIC 2LQTA 1AR1B 2OCCB 1XBLA 2JGDA 3KCYA 5J2TB 3T1YB 2WSSG 1YTFB 2PUSA 4WFEA 2WWWA 1TA8A 1I0HA 3WB1A 3ASNC 2YIDA 4LF9B 1AI5A 2QWPB 2CTQA 3MHSC 1THZA 2G38A 4EB6A 5KMGB 1R1BA 3KCXA 1WNSA 4TUYA 3OD4A 5JCOA 4ZHQA 2YIAA 4LFBO 3K03A 1IBLO 2F23A 3MHHC 1HW7A 3DXRB 1VQ9V 3RYCB 4J42A 4NB5A 2D3OW 3KG2A 3IAYA 4X64B 1VQ4V 3CSXA 2UU9B 3CEIA 2DOSA 3CC2V 4BWAA 3CYOA 3SJBC 3J81N 4FFKA 3ZEDA 2QWQB 4NTXA 3EHBB 1GN6A 4WFHA 2YUAA 1B6QA 4R8CA 5EC2C 3CP1A 1NU1H 1YDXA 4LF6B 4KHPO 4J7JA 4X9QA 2DN9A 3AG2C 1AVMA 2EINB 1H2GA 3VOUA 1OCOB 1MOFA 1OCZC 2ILMA 3U0ZA 1CEZA 2UXXA 3WFVA 3MAQA 4YJ2A 3W7SA 3K5MA 1FXKB 3SDLA 4IHJB 4CS4A 1GM7A 4IGGA 3Q4HB 4LC1A 2WLLB 3N2KB 1F51A 2JEXA 4GZRB 4LF7O 1NI8A 4UCTA 3SPIA 1XREA 2QKAA 1X4TA 4FMTA 4MVRA 3BY6A 5IYZA 1FXKA 2UXBO 3H9VA 3HKBB 3L70H 3RYHA 3ZMZA 4LF4O 4W4LA 5KA6A 4LWSA 3S3WA 1QVFU 4JYYA 3T4DA 1U97A 4LR3A 4FPPA 4EFEA 2N04A 1VF6A 4PDVA 3LSUA 3E8GA 4P30A 1I5YA 2WA3A 4LP8A 1UJWB 4TV8A 4UCSA 4TOIA 3MDSA 1BMFG 1NH2D 4BW5A 5IT9N 3W7UA 5LL6Y 1SQVH 2CH7B 1XQ8A 3PN1A 3SJQC 1Y74A 2ZIOA 4B3TB 3JAKB 2ZE7A 5LOVA 3T1YO 3K9AA 2QDOA 4MVOA 1JJ2U 4AQYO 1YEWA 1WJZA 1OCRC 3B8MA 3FYEB 3P30A 4QNHB 3APOA 1WPBA 1EN5A 1RPRA 1NVPB 4JI5O 2Q5ZA 5IJ9A 4I5SA 3KKYA 1YIJV 2QTSA 3JD1A 3G6BA 4MTXA 2F1MA 3JALA 3ZCCA 1YSCA 3E83A 3B8NA 4F6RA 1UPGA 3K5NA 5D5QA 2EBOA 1PNMA 2WLIA 2V1DA 1NBMG 4YHHO 1TGOA 5LGNA 4YY3B 5FNVA 4GKJB 5CB4A 2Y4UA 2X6AA 1Q6IA 4JGSA 4ZHQB 4X66O 1NVPD 2GTSA 1QVGU 2Q73A 1WGEA 2ZR3A 1BHAA 3WB0A 4ZOLA 3RYFB 1IURA 1JJOA 2OYQA 1HNZB 1S3JA 5JJNB 4CS3A 1S0VA 5CA0A 3SYOA 5KHJA 4JPRA 3OMIB 4JAUA 4DR3O 2DYRC 4DXWA 1M56B 2XAFA 3AK3A 1QU7A 3SPJA 1FJGB 3JYCA 1SQFA 2ZDIA 4DR6O 1XMQB 4BIOA 2WA4A 2E74B 4R7CA 1FJGO 4MTOA 3E35A 5IY5B 2VQEB 3K0DA 2QWRB 1XL4A 5JVDA 1WA8B 3FB8C 2XAGA 1KUQA 3OMAB 5ITZA 1MMMA 1PV0A 4NYKA 1V55C 3BHPA 1XHZA 1GKFA 1IBLB 3AG2B 2EIMC 2DE0X 4JV5O 4QPJA 4WF9V 2XAJA 1Q6UA 1BT8A 3K5OA 2UXBB 4JI8O 1BL8A 1U96A 4DK1A 3L73H 2X6BA 4B3MB 4OX9B 2WPDG 3A0RA 5E79Z 1SZTA 2L6LA 5ITZB 1CPYA 2DWDC 5GTIZ 1WP7A 1XHXA 5AX2A 1M4UA 3AG3B 2R72A 4D6TH 2D2CB 3EXAA 1H8EG 2Q0AA 4ZIBA 1ENVA 2EIJC 2HR3A 2UUBO 1K33A 3K57A 2DJVA 5GTHZ 1GH6A 3X2QB 4TQFA 2JRIA 1H8HG 4G2KA 4YXWG 4CH6A 1Y76B 3P32A 3OUSA 4JI5B 1GN3A 3FB7C 5LHHA 2YI8A 5DM6V 2YXYA 4K0KO 4JI7O 1D5AA 2ATKC 3VQYA 4D4PA 5KX5B 4X1IA 4K8XA 4DR6B 4HNAA 2JVDA 4WBNA 1FPOA 5CBHA 3D36A 4DV7B 3CCSV 3JCUZ 1S72V 1XUQA 4DR7O 1QLEC 3LNNA 5KX5A 4DR5O 5B1BB 1HP8A 3Q4HA 4JI3O 2WLLA 1GO3F 1RPOA 1R3LC 2RQ6A 4E2LA 2JS5A 3K06A 1XNQO 2XT9A 4MTFA 2FB5A 4P9PA 4CZZA 1FD9A 4LF4B 1YJ9V 1IXBA 1VQLV 2Y0IA 2OT5A 2QWOB 3CWBH 5H5NA 2YXHA 1B04A 4WFAV 3T2MA 3I56V 1N0NA 4B3RO 5L3DA 3G71V 1J5EB 3OR6C 4O4IB 4W4KA 2YEVB 2YXLA 3TXQA 2ZT9B 3JSNA 2DYSB 2KKWA 5CA3A 1E1QG 1XMOO 1KU9A 5BR8B 5FPRA 3THOA 1SQBH 4DV0O 3AG4C 3N27A 3E2EA 1YZBA 4NR1A 2GV9A 3OTOB 1Q7YW 2WLNA 5B1AC 4MVUA 4JYCA 4CH5A 2P4VA 4HYOA 4U3JB 2EIMB 1VQOV 3CC7V 4UFZA 2CDYA 4Z1MG 3B09A 1IXMA 4J80A 3IC9A 5EBWC 5B1OA 1GN2A 2FKXA 5HFMA 3ABLC 3AG3C 4UB8Z 3E8BA 1NJIW 3VBBA 2IH3C 4I0XB 4NTYA 2Y48A 1K5SA 3ZIAG 2JK5C 4FZ1A 3STZC 5F2VO 1S77D 2P6JA 5CN0A 3IFXA 2FMLA 3U11A 1ZUQA 2P67A 1W0KG 4JI0O 1QHTA 4F6EA 4ZBMA 2JJ2G 4MT8A 2H8PC 3W7WA 4B3SB 2ITCC 4I4TB 3C3TA 4L8JA 2Z0AA 4X64O 3F5WC 4FLZA 2F4VB 4PDLA 3ASOC 4WFBV 3FFQA 3FAVA 3OE7G 3SYQA 5LHIA 2PF4E 2OCCC 4J10A 1ZLZA 4DO2A 4O4LB 4DUZO 2GDSA 2GBOA 3ZN1A 3OT7A 1ZSPA 4DRXB 3HKEB 1ZX3A 4CC5A 2UUAO 1SKVA 5BY1A 2EIKB 4ZI7A 1YXBA 3U10A 1YTFD 3AG1B 2IW5A 1FFXB 2M7WA 4YJ3B 3UO3A 2PY5A 4EFBA 3JAKA 5CA0B 3UT5B 2R9IA 4MVZA 4YJ2B 3GWOA 2PYJA 4H0LB 2IU3A 4N21A 4I9WA 1VQPV 1Q82W 3D3IA 1H2MA 2YIBA 1FAFA 2HKOA 1B06A 1M93A 3NR7A 5CBGA 5A2QN 1FXHA 5JQGB 2PI5A 3JARB 2JEUA 1T5EA 1XNQB 4TWKA 2JS3A 1NKDA 4H44B 1K34A 3RGBA 3CS5A 1G1XB 4D7SA 2Q7HA 1G4YB 5KHKA 1HR0B 4IYIA 2GHYA 1FXVA 1VF6C 3CCEV 1KECA 1NQTA 4YY3O 5TISZ 2E5LB 2EJ7A 4JTDB 1EBOA 3OUFA 5KLVH 1TUBA 1K4CC 1AJPA 3ZRWA 3JD4A 2F43G 3S3XA 1DLBA 5EIBD 1NS1A 1SQGA 4O2AA 3PJSK 4K3AA 2WLHA 3UCSC 3N2GB 5B3SC 3OW2U 2YS8A 2KQXA 3R66A 2HLDG 1TAEA 4HBNA 4H33A 5LP6C 3JCZA 3P3PA 5IYCO 2CTWA 1L8DA 3OEHG 3QF7A 3RYFA 2XASA 2PZSA 4DV5O 3FX7A 4AQYB 1TVKB 4JF3A 2EZOA 3M7MX 1K8AW 1DF5A 3TXSA 2Y69B 1FXKC 4MW8A 1X59A 3ABTA 5LBQA 4MW3A 1QBZA 3CRAA 3G6EV 3UKMA 3SPCA 1FFTB 5LA6B 3E86A 1QNMA 4CS2A 2GUZA 3QTCA 4FLYA 3VQWA 1M57B 2B1GA 3X2QC 4GKKO 2DWEC 3F7VC 4DUYB 5FNVB 4BIUA 2XHBA 1KD1W 4GCZA 2P90A 2X7RB 1G8MA 3OEEG 1N33B 1R3KC 1BS3A 5H9CA 4RQFA 4WFGA 4X20A 1A32A 1WAZA 3ZMVA 2LGWA 1IBKO 5JCOC 4U3FH 1TUEB 3ABLB 4AI8A 1MG1A 2VWJA 1VQNV 5C8YB 4GX0A 3ZHQA 2DW4A 2PTMA 2ZQMA 2B9ZA 2Y4TA 4JI1O 3VQXA 4UV9A 5EBMC 4K0KB 4LF5B 3BPZA 3K3WA 1KC8W 3MD0A 4FLXA 1DF4A 4B7EA 5GW7A 3JARA 4AHCA 4FZ0A 5JH7B 1NTZH 4AILC 4JI2O 4NVPA 4UVAA 1V55B 3JSLA 2QM4A 3ASNB 4PV1B 2V7QG 4O4IA 1GN4A 2L35A 3RT3C 1NTKH 2AHYA 3CJHA 4FLUA 3M99B 4ABMA 2W6JG 3J7AU 4PJ0Z 4JI3B 5GONA 2A0LA 5LYJA 1AI6A 4QE7A 4FVMA 3QG5A 4MVQA 1XNRB 2ZE5A 3BABA 3HKCB 3L75H 2CTRA 3IJ4A 3F7YC 4DV3B 1OV9A 2EIKC 4B3SO 1K92A 4QIWF 1QCEA 3H1JH 3HKDA 3LUTB 5EYPB 3ZRVA 1SETA 3ABMC 4DR4O 2JGUA 2BTQB 1IBMO 4YIPA 5HFLA 4PA4A 4X1YB 1Q90D 5LMUB 4Z2WA 2ZD9A 2DQ3A 4DUZB 1IDSA 4LFBB 3QO5A 3ZBHA 2EX3A 1EN4A 1YJWV 2IU0A 3CRCA 2ZM6O 2Q6AA 1S5HC 1N0JA 3FAVB 4LH6A 4FLWA 3K58A 4FFBB 3T1CA 5LP6A 1RSOA 4EKWA 4UCRA 3OMNB 1I94O 4G27B 1TUBB 1Y76A 1VARA 3ZHRA 1AI7A 2OTJV 1EN6A 1OCCC 2GUZB 4LFCB 4O2AB 4LF8B 1Y74B 3LDCA 3CRQA 5EBLC 1PNLA 3RYIB 4I55A 4J9ZB 2BCCH 1MNGA 4G28B 1DTOA 5L3FA 4JV5B 3H01A 3JAWA 1SQXH 4LH7A 2ZE6A 3K04A 4GYCB 1OCCB 2GTAA 3OFNG 4WBNB 4DV2B 4KP4A 4DR7B 3ABUA 3TGUH 4NXNB 2ZKOA 1P84F 4NKGB 1JPXA 1MZEA 5KAFZ 3UT5A 3LSSA 3AG4B 4C7UA 1PL4A 3F5TA 1W0JG 1YI2V 2LFRA 2HHHO 2AGAA 1BE3H 5DEDA 1P49A 2DMXA 4MTGA 2ZM6B 3RYCA 2ZXWC 2EZPA 3LDDA 1AROP 3OTOO 1M1KW 2HG5C 4JI1B 1IZ3A 4GKKB 4X33A 1I5XA 2VQFB 2KB1A 2ADPA 4J7ZA 1F4MA 5B3SB 4JZ2A 3CB2A 2QM7A 5CA1B 5H2FZ 1JR9A 3BFRA 2KG7A 4ZI7B 3ZHTA 1LUVA 4E4EA 5L3GA 5CB4B 4LFAB 1HNZO 4D7TA 4O4LA 3ETQA 3N2GA 5KUMA 4LF7B 4NTWA 3CRMA 3JAMN 2RCVA 2WLJA 4LF5O 3NXSA 4YHHB 2AW9A 2WAMA 3FD9A 4DV7O 3EVKA 5J2UB 2YI9A 2R9RB 2E3CA 4B08A 3QO7A 5JJEB 2P06A 2QKSA 1P7GA 2BE3A 4Q20A 4DW0A 3D3QA 3B77A 1COWG 4RAIA 4X8AA 1VF7A 4JI8B 5IYZB 2HVKC 2M6YA 1QQCA 3FB5C 1VF5B 4JI4B 2YSUB 2GSMB 2AZ0A 4P2ZA 3P3NA 5FLXN 1YWSA 2QSAA 2Z5UA 3ZRSA 1R6TA 2ZDIC 2E5LO 3G67A 4DV3O 1GRJA 4GLXA 5L3BA 5L3EA 2LFSA 3RYHB 4UB6Z 2QKCA 3ETDA 3FKSG 4K35A 4K8ZA 2Z3YA 5J2TA 2QWNB 4FM0A 1I7FA 1NTMH 1JFFB 2ADQB 4B3TO 3IGAC 3O9OA 4JYAB 4PDMA 2VRZA 3FB6C 3HR0A 2RNBA 1VQ6V 3BA8A 3T4ZA 3ETEA 2ZNIA 3CCRV 1MABG 2UXNA 1E1RG 2CK3G 5B5EZ 3HKEA 4QE9A 3N2KA 1US6A 3SJAC 1MA1A 5KHIA 1ZAUA 2CUGA 4BIZA 1PKXA 3KZIZ 2JIZG 4JI0B 3ASOB 1H2LA 1KYOF 2ODMA 1L0NH 2K9PA 3CX5F 3H1IH 4FFBA 4KL1A 5LP6B 2YC0A 4BR6A 1H2SB 1ROPA 3TETA 1AJNA 5FPOA 4FIPC 1SC5B 1VQMV 1K7DA 3JASB 3C3SA 4F6RB 4FM1A 3L9DA 5CMUA 2R70A 1L0LH 3WG7C 4KXRA 3M8AA 4JI4O 3G4SV 5E1AC 5KHGA 3CC4V 3CRRA 1N32B 4GUNA 3R65A 1V54B 4DK0A 1W2BU 2CAZC 4RUFA 3ETGA 3RVZA 2UUAB 1N32O 5EIBC 3CD6V 2RJZA 1AP5A 1H2NA 3RW0A 5H6QA 4MVMA 4EEQA 1KMIZ 2UXDO 2VS0A 5DN6G 2BSKB 1SZXA 4X1KB 1V9PA 1F7YA 1Q3EA 1XL6A 4IIJB 1XI1A 1HDJA 1NH2B 5JWPA 2XNDG 3E22A 3DC6A 1Z2GA 4JYBA 1RM1C 2W0XA 4J11A 3BVOA 3SYCA 2EJRA 5EK0A 2FTKA 1WB7A 2V4DA 2EILC 3UM7A 1SESA 3E22B 2LGQA 2P22C 3AG1C 3ZMSA 2E76B 2A79B 1ZL8A 3TJTA 4O2BA 4PDRA 1JOYA 1IX9A 3DTUB 1Q8IA 2CTPA 3CCQV 2MW2B 2ETNA 5LOVB 5IYDO 4ZOLB 2Q9LA 4MS2A 2RN9A 3OGIB 2JGDB 1IBMB 4IT5A 5BXZA 1ZL8B 5KUKA 2ZIMA 5BR8O 4X65B 2QE7G 4XBFA 3CCLV 2F4VO 4O4JB 1K73W 5IWAO 1M57C 3VQVA 1D5NA 2QR4A 4IL6Z 2LW7A 3CXCU 2YICA 3OTFA 3STLC 2JR7A 4GX5A 1F23A 1HNXO 3RN4A 2OWOA 1S5LZ 4DV4O 1KKDA 4LFAO 4I7ZB 3RBZA 2Q7GA 2CGOA 3L71H 1HNXB 5CA1A 1GMGA 3TK1A 3JD3A 4ASUG 4JASA 3K59A 1WB8A 4PELA 2ZXWB 4DV5B 4UCUA 1ORQC 4LF8O 5JVDB 1OJHA 3ZS8C 4DR2O 4DR5B 4DV1B 1Q43A 4GX2A 1AB3A 2Q69A 4I50A 1B3QA 1N8RW 1RP3B 3LDEA 3CJHB 3TCUA 3WU2Z 1XEQA 5B1AB 1N34O 2BTOA 5BZBA 3A2FA 4FLTA 4DV2O 5LMUO 4TV8B 2Q4PA 2N74A 1IBKB 4TT3G 1N34B 3ZN0A 4LCUC 4B3MO 3HKCA 3HB3B 1BSMA 3SR2C 1N36O 3AG7A 3ZJZA 1Q81W 1PNKA 2W0FC 1MSDA 1VEWA 1AR5A 3ZMTA 3ZHVA 4DV6B 4KUMA 3FYIB 1R73A 1AJQA 1WN7A 1VIBA 1YITV 1WP8A 2PGGA 2RMKB 4JYAO 1WLEA 4DW1A 4RQEA 1HNWO 3HKBA 5IYBO 1XDCA 4UVBA 3EFFK 3DGEA 1QLEB 4X1IB 1O9GA 2RDCA 2LW1A 4CH4A 3CCMV 1SQQH 1ZTEA 4I9QA 3JALB 2DYSC 5JJJB 3A0BZ 2VQEO 4IIJA 1RSOB 1M5IA 2LJ2A 1QR9A 2X0LA 3QVNA 1H38A 1VQ5V 3CE2A 5LHGA 5J9PC 3UO2A 4DR4B 3A0HZ 4JTAB 1SA0A 3ABMB 1SF9A 1YVWA 3ICXA 4RWUA 1K5QA 4PA3A 1Z5VA 4CC6A 5IE9A 1SRYA 5K1XA 4YIOA 2B5UA 1TVKA 2AXTZ 3SPHA 2EIJB 2XAQA 1UFIA 1PPJH 1N4CA 4U7NA 3ZX6A 4J41A 4PA6A 2K1EA 5AG2A 2ARHA 4XDJA 3AEIA 5BMVB 4OGQB 2EULA 5IJ0A 2HVJC 4A5UB 1SERA 3E89A 1HNWB 1K97A 3E8HA 1GK9A 2H3OA 2IBZH 4UVCA 2VWKA 1GM9A 1FKAO 1DGSA 3DSQA 4HNAB 4PI2A 2N05A 3SYPA 4WCEV 4LF6O 4KHPB 2DQ0A 1CP9A 5KHHA 1M90W 4LFCO 4D4OA 4O4JA 4DYLA 1MZFA 3IC7A 2AZ2A 1QLNA 3RVYA 3BCCH 4DR3B 4X88A 3ABKC 3AK2A 3GVMA 3I55V 4PD4F 1KB9F 1R6KA 4UCOA 2NN4A 3T1HB 2C2AA 1XILA 2P5OA 5J2UA 3CPWU 1OHHG 4P9OA 4PHZA 2BSKA 2X6CA 3JD2A 2YEVA 1BHBA 4TUYB 2MK3A 1NZ6A 4HZ3A 2BOCC 1LR1A 2PI4A 2DYRB 5JQGA 1VP7A 4GKJO 1KP3A 2FL4A 1YJNV 5EC1C 1PL0A 4DV1O 5LXTB 2ITDC 3G80A 2PYLA 3B2EE 1SQPH 3OM3B 1PD3A 4O4HB 3W7XA 4B3RB 2UXCO 4OX9O 1BQZA 1EFRG 5FL7G 5IDJA 2Q67A 1MSWD 4IHJA 3BA9A 4Q6GA 4I0XA 3JATA 5DECA 3LNMB 1N36B 1AR4A 3O65A 1FFXA 2UXDB 4IYHA 4O4HA 1LNQA 4DR1O 4DV6O 3H1HH 1BGYH 1W59A 4DV4B 3T1HO 2ZCEA 5LGTA 2QTOA 2ZNJA 2IJKA 2LP7A 1OZ0A 3CCVV 3H1LH 2UUCB 4PA9A 4X62O 1JCHA 3JATB 4U7OA 1JQ0A 4XDLA 2YIBD 1JX9A 4X1KA 2YDEA 1URFA 3K0GA 4DR2B 3OGCC 3JD0A 2W6IG 2CGNA 2HHHB 4I55B 4BW9A 5KA5A 5EZYB 5A9GA 3SPGA 1PM9A 3RFRA 3CHXA 1EZVH 3ML0A 3UQ8A 1N33O 4GT1A 4KFMA 1M9NA 1AI4A 4DRXA 2R9AA 5B1NA 1XMOB 1RFYA 1VQ8V 3ZHUA 3LSQA 3BRCA 4MVSA 4F4LA 2NNUA 1F4NA 4DV0B 1J5EO 2XAHA 3WB2A 3GB7C 4X66B 1I94B 4YJ3A 1Y6XA 4H37A 1RM1B 1H2KA 2HFEC 4FM2A 1CXZB 5IWAB 4L87A 3OR7C 4JI6B 1XOUA 2F95B 5C8YA 4NXMO 3DC5A 1GAXA 4JI6O 4H13B 5CBFA 3K9SA 1R3IC 4R6ZA 5BMVA 4PI0A 5IJ0B 2AHZA 2HEPA 2CE4A 2P4KA 3APQA 4J9YB 4TV9A 4FJCC 3SGIA 5B1BC 1P4RA 1Y4MA 4UCVA 2A9HA 2WLIB 2VQFO 2ZINA 1V54C 1FS0G 2XTAA 4MSWC 1IVSA 1P7BA 1YF2A 4OXSA 2A3QA 1XNRO 4TQDA 3I5DA 1Y67A 4QPKA 4LF9O 2B1IA 2LO1A 2F66C 5LYJB 3RYIA 4I4TA 1OCZB 1Q5OA 3DXRA 2EINC 4I50B 4JTCB 4WFFA 1D2DA 2QA4V 1QR8A 2H94A 2ZR2A 3B40A 4U3JA 1L1FA 2HJFC 2QGNA 4PA7A 1Q6HA 3W7TA 2QEXV 3QO8A 5EYPA 5L3CA 3D36C 2UUBB 2BTQA 2XOKG 3K79A 1VQKV 2OCHA 3ZRWB 3ABKB 4BAYA 3HKDB 2UXCB 4UXNA 4CBCA 2UU9O 5LMNO 3A8TA 1AP6A 1KKCA 4FLVA 4B7KA 1R3JC 2WLKA 4ICGA 1J95A 1WA8A 3CCUV 3J80N 1S76D 1GM8A 5D5PA 5JH7A 4R50A 5H6RA 1EZJA 4LWSB 4OPHA 4X89A 1YOPA 3K08A 1VQ7V 3K5LA 3BAAA 3E8FA 4EB6B 2A7WA 5KMGA 4X62B 1G6UA 2P7TC 2KSDA 1R6NA 5B66Z 4RUEA 4TSFG 5GONB 1I08A 4JZGA 1EM1A 3C90A 4LBEC 1Z5WA 1OCRB 5K1PA 1K9MW 2HJDA 3JAWB 2WLMA 2JDIG 4DUYO 2NR5A 1M56C 1AILA 1BQ0A 2UUCO 2XUMA 3D8CA 2O57A 4JAVA 2F93B 4TV9B 4XDKA 2A06H 4RO2A 3OAAG 2QM8A 2ZE8A 3L72H 4QJFB 3HPLC 4X1YA 4LNUB 3GWKC 3SJCC 3QNEA 3SYAA 5KAIZ 5LXTA 1DK1A 4J7KA 5C93A 4UV8A 4JAAA 4QGPA 1KP2A 4JI2B 1KQSU 2JJ1G 2OIEA 1NR1A 4LNUA 3CMAV 4X65O 4HAMA 2OIGA 1JFFA 2EILB 4OPAA 3AK1A 3BEHA 5LGUA 2IJJA 2QJ1A 4JI7B 3CMEV 1JVMA 3ZRXA 2NLJC 1NT2B 2HP8A 1JA8A 1E79G 4UUJC 1YCIA 4DR1B 2IM9A 2Q68A 2IH1C 4Z1VA 2IJIA 2CH7A 1OCOC 1SA0B 1HR0O 1WPXA 4FK5C 2Q0OC 1FYJA 4NXNO 4X20B 3CCJV 2Q8VA 2FYUH 3B4SA 4CH3A 5LMNB 4GX1A 2Y69C 3JASA 1NR7A 2BOBC 1K4DC 1PP9H 2Y0PA 1YHQV 1BCCH 1Q86W 1LUWA 3H1KH 1BZKA 1SS3A 1GTOA 5IY5C 5IJ9B 3RWRD 4NXMB 3L74H 2E75B 1K3EA 5EZYA 3ZMUA 3WG7B 3CXHF 1KBHA 4ZKIA 2OTLV 2IJHA 2Q7EA 1JMKC 4N23A 5LA6A 2KG7B 4O2BB 3ZHSA 1O9HA 1HWYA 1S5JA 1VMGA 1XMQO 1Y66A
chains in the Genus database with same CATH topology
2YUAA 2L6LA 4X33A 1XBLA 1WJZA 2QWOB 1BQZA 2CTWA 2OCHA 2M6YA 1WGEA 2DMXA 4J7ZA 2LGWA 2JR7A 2CTRA 2QWNB 1N4CA 3AG7A 3APOA 1IURA 5AX2A 4IT5A 2CUGA 2GUZA 4D4PA 3UO2A 1YOPA 1YWSA 2GUZB 2QSAA 2N05A 2DN9A 2Y4TA 1FAFA 3UCSC 2N04A 3BVOA 1BQ0A 2QWPB 2CTQA 1FPOA 4RWUA 2PF4E 2YS8A 3UO3A 1GH6A 2CTPA 2KQXA 4D4OA 1NZ6A 2QWRB 4J80A 3APQA 2QWQB 1HDJA 2LO1A 2Y4UA 2EJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUA A;  2L6L A;  4X33 A;  1XBL A;  1WJZ A;  2QWO B;  1BQZ A;  2CTW A;  2OCH A;  2M6Y A;  1WGE A;  2DMX A;  4J7Z A;  2LGW A;  2JR7 A;  2CTR A;  2QWN B;  1N4C A;  3AG7 A;  3APO A;  1IUR A;  5AX2 A;  4IT5 A;  2CUG A;  2GUZ A;  4D4P A;  3UO2 A;  1YOP A;  1YWS A;  2GUZ B;  2QSA A;  2N05 A;  2DN9 A;  2Y4T A;  1FAF A;  3UCS C;  2N04 A;  3BVO A;  1BQ0 A;  2QWP B;  2CTQ A;  1FPO A;  4RWU A;  2PF4 E;  2YS8 A;  3UO3 A;  1GH6 A;  2CTP A;  2KQX A;  4D4O A;  1NZ6 A;  2QWR B;  4J80 A;  3APQ A;  2QWQ B;  1HDJ A;  2LO1 A;  2Y4U A;  2EJ7 A; 
#chains in the Genus database with same CATH topology
 1ZWI C;  2LQT A;  1AR1 B;  2OCC B;  1XBL A;  2JGD A;  3KCY A;  5J2T B;  3T1Y B;  2WSS G;  1YTF B;  2PUS A;  4WFE A;  2WWW A;  1TA8 A;  1I0H A;  3WB1 A;  3ASN C;  2YID A;  4LF9 B;  1AI5 A;  2QWP B;  2CTQ A;  3MHS C;  1THZ A;  2G38 A;  4EB6 A;  5KMG B;  1R1B A;  3KCX A;  1WNS A;  4TUY A;  3OD4 A;  5JCO A;  4ZHQ A;  2YIA A;  4LFB O;  3K03 A;  1IBL O;  2F23 A;  3MHH C;  1HW7 A;  3DXR B;  1VQ9 V;  3RYC B;  4J42 A;  4NB5 A;  2D3O W;  3KG2 A;  3IAY A;  4X64 B;  1VQ4 V;  3CSX A;  2UU9 B;  3CEI A;  2DOS A;  3CC2 V;  4BWA A;  3CYO A;  3SJB C;  3J81 N;  4FFK A;  3ZED A;  2QWQ B;  4NTX A;  3EHB B;  1GN6 A;  4WFH A;  2YUA A;  1B6Q A;  4R8C A;  5EC2 C;  3CP1 A;  1NU1 H;  1YDX A;  4LF6 B;  4KHP O;  4J7J A;  4X9Q A;  2DN9 A;  3AG2 C;  1AVM A;  2EIN B;  1H2G A;  3VOU A;  1OCO B;  1MOF A;  1OCZ C;  2ILM A;  3U0Z A;  1CEZ A;  2UXX A;  3WFV A;  3MAQ A;  4YJ2 A;  3W7S A;  3K5M A;  1FXK B;  3SDL A;  4IHJ B;  4CS4 A;  1GM7 A;  4IGG A;  3Q4H B;  4LC1 A;  2WLL B;  3N2K B;  1F51 A;  2JEX A;  4GZR B;  4LF7 O;  1NI8 A;  4UCT A;  3SPI A;  1XRE A;  2QKA A;  1X4T A;  4FMT A;  4MVR A;  3BY6 A;  5IYZ A;  1FXK A;  2UXB O;  3H9V A;  3HKB B;  3L70 H;  3RYH A;  3ZMZ A;  4LF4 O;  4W4L A;  5KA6 A;  4LWS A;  3S3W A;  1QVF U;  4JYY A;  3T4D A;  1U97 A;  4LR3 A;  4FPP A;  4EFE A;  2N04 A;  1VF6 A;  4PDV A;  3LSU A;  3E8G A;  4P30 A;  1I5Y A;  2WA3 A;  4LP8 A;  1UJW B;  4TV8 A;  4UCS A;  4TOI A;  3MDS A;  1BMF G;  1NH2 D;  4BW5 A;  5IT9 N;  3W7U A;  5LL6 Y;  1SQV H;  2CH7 B;  1XQ8 A;  3PN1 A;  3SJQ C;  1Y74 A;  2ZIO A;  4B3T B;  3JAK B;  2ZE7 A;  5LOV A;  3T1Y O;  3K9A A;  2QDO A;  4MVO A;  1JJ2 U;  4AQY O;  1YEW A;  1WJZ A;  1OCR C;  3B8M A;  3FYE B;  3P30 A;  4QNH B;  3APO A;  1WPB A;  1EN5 A;  1RPR A;  1NVP B;  4JI5 O;  2Q5Z A;  5IJ9 A;  4I5S A;  3KKY A;  1YIJ V;  2QTS A;  3JD1 A;  3G6B A;  4MTX A;  2F1M A;  3JAL A;  3ZCC A;  1YSC A;  3E83 A;  3B8N A;  4F6R A;  1UPG A;  3K5N A;  5D5Q A;  2EBO A;  1PNM A;  2WLI A;  2V1D A;  1NBM G;  4YHH O;  1TGO A;  5LGN A;  4YY3 B;  5FNV A;  4GKJ B;  5CB4 A;  2Y4U A;  2X6A A;  1Q6I A;  4JGS A;  4ZHQ B;  4X66 O;  1NVP D;  2GTS A;  1QVG U;  2Q73 A;  1WGE A;  2ZR3 A;  1BHA A;  3WB0 A;  4ZOL A;  3RYF B;  1IUR A;  1JJO A;  2OYQ A;  1HNZ B;  1S3J A;  5JJN B;  4CS3 A;  1S0V A;  5CA0 A;  3SYO A;  5KHJ A;  4JPR A;  3OMI B;  4JAU A;  4DR3 O;  2DYR C;  4DXW A;  1M56 B;  2XAF A;  3AK3 A;  1QU7 A;  3SPJ A;  1FJG B;  3JYC A;  1SQF A;  2ZDI A;  4DR6 O;  1XMQ B;  4BIO A;  2WA4 A;  2E74 B;  4R7C A;  1FJG O;  4MTO A;  3E35 A;  5IY5 B;  2VQE B;  3K0D A;  2QWR B;  1XL4 A;  5JVD A;  1WA8 B;  3FB8 C;  2XAG A;  1KUQ A;  3OMA B;  5ITZ A;  1MMM A;  1PV0 A;  4NYK A;  1V55 C;  3BHP A;  1XHZ A;  1GKF A;  1IBL B;  3AG2 B;  2EIM C;  2DE0 X;  4JV5 O;  4QPJ A;  4WF9 V;  2XAJ A;  1Q6U A;  1BT8 A;  3K5O A;  2UXB B;  4JI8 O;  1BL8 A;  1U96 A;  4DK1 A;  3L73 H;  2X6B A;  4B3M B;  4OX9 B;  2WPD G;  3A0R A;  5E79 Z;  1SZT A;  2L6L A;  5ITZ B;  1CPY A;  2DWD C;  5GTI Z;  1WP7 A;  1XHX A;  5AX2 A;  1M4U A;  3AG3 B;  2R72 A;  4D6T H;  2D2C B;  3EXA A;  1H8E G;  2Q0A A;  4ZIB A;  1ENV A;  2EIJ C;  2HR3 A;  2UUB O;  1K33 A;  3K57 A;  2DJV A;  5GTH Z;  1GH6 A;  3X2Q B;  4TQF A;  2JRI A;  1H8H G;  4G2K A;  4YXW G;  4CH6 A;  1Y76 B;  3P32 A;  3OUS A;  4JI5 B;  1GN3 A;  3FB7 C;  5LHH A;  2YI8 A;  5DM6 V;  2YXY A;  4K0K O;  4JI7 O;  1D5A A;  2ATK C;  3VQY A;  4D4P A;  5KX5 B;  4X1I A;  4K8X A;  4DR6 B;  4HNA A;  2JVD A;  4WBN A;  1FPO A;  5CBH A;  3D36 A;  4DV7 B;  3CCS V;  3JCU Z;  1S72 V;  1XUQ A;  4DR7 O;  1QLE C;  3LNN A;  5KX5 A;  4DR5 O;  5B1B B;  1HP8 A;  3Q4H A;  4JI3 O;  2WLL A;  1GO3 F;  1RPO A;  1R3L C;  2RQ6 A;  4E2L A;  2JS5 A;  3K06 A;  1XNQ O;  2XT9 A;  4MTF A;  2FB5 A;  4P9P A;  4CZZ A;  1FD9 A;  4LF4 B;  1YJ9 V;  1IXB A;  1VQL V;  2Y0I A;  2OT5 A;  2QWO B;  3CWB H;  5H5N A;  2YXH A;  1B04 A;  4WFA V;  3T2M A;  3I56 V;  1N0N A;  4B3R O;  5L3D A;  3G71 V;  1J5E B;  3OR6 C;  4O4I B;  4W4K A;  2YEV B;  2YXL A;  3TXQ A;  2ZT9 B;  3JSN A;  2DYS B;  2KKW A;  5CA3 A;  1E1Q G;  1XMO O;  1KU9 A;  5BR8 B;  5FPR A;  3THO A;  1SQB H;  4DV0 O;  3AG4 C;  3N27 A;  3E2E A;  1YZB A;  4NR1 A;  2GV9 A;  3OTO B;  1Q7Y W;  2WLN A;  5B1A C;  4MVU A;  4JYC A;  4CH5 A;  2P4V A;  4HYO A;  4U3J B;  2EIM B;  1VQO V;  3CC7 V;  4UFZ A;  2CDY A;  4Z1M G;  3B09 A;  1IXM A;  4J80 A;  3IC9 A;  5EBW C;  5B1O A;  1GN2 A;  2FKX A;  5HFM A;  3ABL C;  3AG3 C;  4UB8 Z;  3E8B A;  1NJI W;  3VBB A;  2IH3 C;  4I0X B;  4NTY A;  2Y48 A;  1K5S A;  3ZIA G;  2JK5 C;  4FZ1 A;  3STZ C;  5F2V O;  1S77 D;  2P6J A;  5CN0 A;  3IFX A;  2FML A;  3U11 A;  1ZUQ A;  2P67 A;  1W0K G;  4JI0 O;  1QHT A;  4F6E A;  4ZBM A;  2JJ2 G;  4MT8 A;  2H8P C;  3W7W A;  4B3S B;  2ITC C;  4I4T B;  3C3T A;  4L8J A;  2Z0A A;  4X64 O;  3F5W C;  4FLZ A;  2F4V B;  4PDL A;  3ASO C;  4WFB V;  3FFQ A;  3FAV A;  3OE7 G;  3SYQ A;  5LHI A;  2PF4 E;  2OCC C;  4J10 A;  1ZLZ A;  4DO2 A;  4O4L B;  4DUZ O;  2GDS A;  2GBO A;  3ZN1 A;  3OT7 A;  1ZSP A;  4DRX B;  3HKE B;  1ZX3 A;  4CC5 A;  2UUA O;  1SKV A;  5BY1 A;  2EIK B;  4ZI7 A;  1YXB A;  3U10 A;  1YTF D;  3AG1 B;  2IW5 A;  1FFX B;  2M7W A;  4YJ3 B;  3UO3 A;  2PY5 A;  4EFB A;  3JAK A;  5CA0 B;  3UT5 B;  2R9I A;  4MVZ A;  4YJ2 B;  3GWO A;  2PYJ A;  4H0L B;  2IU3 A;  4N21 A;  4I9W A;  1VQP V;  1Q82 W;  3D3I A;  1H2M A;  2YIB A;  1FAF A;  2HKO A;  1B06 A;  1M93 A;  3NR7 A;  5CBG A;  5A2Q N;  1FXH A;  5JQG B;  2PI5 A;  3JAR B;  2JEU A;  1T5E A;  1XNQ B;  4TWK A;  2JS3 A;  1NKD A;  4H44 B;  1K34 A;  3RGB A;  3CS5 A;  1G1X B;  4D7S A;  2Q7H A;  1G4Y B;  5KHK A;  1HR0 B;  4IYI A;  2GHY A;  1FXV A;  1VF6 C;  3CCE V;  1KEC A;  1NQT A;  4YY3 O;  5TIS Z;  2E5L B;  2EJ7 A;  4JTD B;  1EBO A;  3OUF A;  5KLV H;  1TUB A;  1K4C C;  1AJP A;  3ZRW A;  3JD4 A;  2F43 G;  3S3X A;  1DLB A;  5EIB D;  1NS1 A;  1SQG A;  4O2A A;  3PJS K;  4K3A A;  2WLH A;  3UCS C;  3N2G B;  5B3S C;  3OW2 U;  2YS8 A;  2KQX A;  3R66 A;  2HLD G;  1TAE A;  4HBN A;  4H33 A;  5LP6 C;  3JCZ A;  3P3P A;  5IYC O;  2CTW A;  1L8D A;  3OEH G;  3QF7 A;  3RYF A;  2XAS A;  2PZS A;  4DV5 O;  3FX7 A;  4AQY B;  1TVK B;  4JF3 A;  2EZO A;  3M7M X;  1K8A W;  1DF5 A;  3TXS A;  2Y69 B;  1FXK C;  4MW8 A;  1X59 A;  3ABT A;  5LBQ A;  4MW3 A;  1QBZ A;  3CRA A;  3G6E V;  3UKM A;  3SPC A;  1FFT B;  5LA6 B;  3E86 A;  1QNM A;  4CS2 A;  2GUZ A;  3QTC A;  4FLY A;  3VQW A;  1M57 B;  2B1G A;  3X2Q C;  4GKK O;  2DWE C;  3F7V C;  4DUY B;  5FNV B;  4BIU A;  2XHB A;  1KD1 W;  4GCZ A;  2P90 A;  2X7R B;  1G8M A;  3OEE G;  1N33 B;  1R3K C;  1BS3 A;  5H9C A;  4RQF A;  4WFG A;  4X20 A;  1A32 A;  1WAZ A;  3ZMV A;  2LGW A;  1IBK O;  5JCO C;  4U3F H;  1TUE B;  3ABL B;  4AI8 A;  1MG1 A;  2VWJ A;  1VQN V;  5C8Y B;  4GX0 A;  3ZHQ A;  2DW4 A;  2PTM A;  2ZQM A;  2B9Z A;  2Y4T A;  4JI1 O;  3VQX A;  4UV9 A;  5EBM C;  4K0K B;  4LF5 B;  3BPZ A;  3K3W A;  1KC8 W;  3MD0 A;  4FLX A;  1DF4 A;  4B7E A;  5GW7 A;  3JAR A;  4AHC A;  4FZ0 A;  5JH7 B;  1NTZ H;  4AIL C;  4JI2 O;  4NVP A;  4UVA A;  1V55 B;  3JSL A;  2QM4 A;  3ASN B;  4PV1 B;  2V7Q G;  4O4I A;  1GN4 A;  2L35 A;  3RT3 C;  1NTK H;  2AHY A;  3CJH A;  4FLU A;  3M99 B;  4ABM A;  2W6J G;  3J7A U;  4PJ0 Z;  4JI3 B;  5GON A;  2A0L A;  5LYJ A;  1AI6 A;  4QE7 A;  4FVM A;  3QG5 A;  4MVQ A;  1XNR B;  2ZE5 A;  3BAB A;  3HKC B;  3L75 H;  2CTR A;  3IJ4 A;  3F7Y C;  4DV3 B;  1OV9 A;  2EIK C;  4B3S O;  1K92 A;  4QIW F;  1QCE A;  3H1J H;  3HKD A;  3LUT B;  5EYP B;  3ZRV A;  1SET A;  3ABM C;  4DR4 O;  2JGU A;  2BTQ B;  1IBM O;  4YIP A;  5HFL A;  4PA4 A;  4X1Y B;  1Q90 D;  5LMU B;  4Z2W A;  2ZD9 A;  2DQ3 A;  4DUZ B;  1IDS A;  4LFB B;  3QO5 A;  3ZBH A;  2EX3 A;  1EN4 A;  1YJW V;  2IU0 A;  3CRC A;  2ZM6 O;  2Q6A A;  1S5H C;  1N0J A;  3FAV B;  4LH6 A;  4FLW A;  3K58 A;  4FFB B;  3T1C A;  5LP6 A;  1RSO A;  4EKW A;  4UCR A;  3OMN B;  1I94 O;  4G27 B;  1TUB B;  1Y76 A;  1VAR A;  3ZHR A;  1AI7 A;  2OTJ V;  1EN6 A;  1OCC C;  2GUZ B;  4LFC B;  4O2A B;  4LF8 B;  1Y74 B;  3LDC A;  3CRQ A;  5EBL C;  1PNL A;  3RYI B;  4I55 A;  4J9Z B;  2BCC H;  1MNG A;  4G28 B;  1DTO A;  5L3F A;  4JV5 B;  3H01 A;  3JAW A;  1SQX H;  4LH7 A;  2ZE6 A;  3K04 A;  4GYC B;  1OCC B;  2GTA A;  3OFN G;  4WBN B;  4DV2 B;  4KP4 A;  4DR7 B;  3ABU A;  3TGU H;  4NXN B;  2ZKO A;  1P84 F;  4NKG B;  1JPX A;  1MZE A;  5KAF Z;  3UT5 A;  3LSS A;  3AG4 B;  4C7U A;  1PL4 A;  3F5T A;  1W0J G;  1YI2 V;  2LFR A;  2HHH O;  2AGA A;  1BE3 H;  5DED A;  1P49 A;  2DMX A;  4MTG A;  2ZM6 B;  3RYC A;  2ZXW C;  2EZP A;  3LDD A;  1ARO P;  3OTO O;  1M1K W;  2HG5 C;  4JI1 B;  1IZ3 A;  4GKK B;  4X33 A;  1I5X A;  2VQF B;  2KB1 A;  2ADP A;  4J7Z A;  1F4M A;  5B3S B;  4JZ2 A;  3CB2 A;  2QM7 A;  5CA1 B;  5H2F Z;  1JR9 A;  3BFR A;  2KG7 A;  4ZI7 B;  3ZHT A;  1LUV A;  4E4E A;  5L3G A;  5CB4 B;  4LFA B;  1HNZ O;  4D7T A;  4O4L A;  3ETQ A;  3N2G A;  5KUM A;  4LF7 B;  4NTW A;  3CRM A;  3JAM N;  2RCV A;  2WLJ A;  4LF5 O;  3NXS A;  4YHH B;  2AW9 A;  2WAM A;  3FD9 A;  4DV7 O;  3EVK A;  5J2U B;  2YI9 A;  2R9R B;  2E3C A;  4B08 A;  3QO7 A;  5JJE B;  2P06 A;  2QKS A;  1P7G A;  2BE3 A;  4Q20 A;  4DW0 A;  3D3Q A;  3B77 A;  1COW G;  4RAI A;  4X8A A;  1VF7 A;  4JI8 B;  5IYZ B;  2HVK C;  2M6Y A;  1QQC A;  3FB5 C;  1VF5 B;  4JI4 B;  2YSU B;  2GSM B;  2AZ0 A;  4P2Z A;  3P3N A;  5FLX N;  1YWS A;  2QSA A;  2Z5U A;  3ZRS A;  1R6T A;  2ZDI C;  2E5L O;  3G67 A;  4DV3 O;  1GRJ A;  4GLX A;  5L3B A;  5L3E A;  2LFS A;  3RYH B;  4UB6 Z;  2QKC A;  3ETD A;  3FKS G;  4K35 A;  4K8Z A;  2Z3Y A;  5J2T A;  2QWN B;  4FM0 A;  1I7F A;  1NTM H;  1JFF B;  2ADQ B;  4B3T O;  3IGA C;  3O9O A;  4JYA B;  4PDM A;  2VRZ A;  3FB6 C;  3HR0 A;  2RNB A;  1VQ6 V;  3BA8 A;  3T4Z A;  3ETE A;  2ZNI A;  3CCR V;  1MAB G;  2UXN A;  1E1R G;  2CK3 G;  5B5E Z;  3HKE A;  4QE9 A;  3N2K A;  1US6 A;  3SJA C;  1MA1 A;  5KHI A;  1ZAU A;  2CUG A;  4BIZ A;  1PKX A;  3KZI Z;  2JIZ G;  4JI0 B;  3ASO B;  1H2L A;  1KYO F;  2ODM A;  1L0N H;  2K9P A;  3CX5 F;  3H1I H;  4FFB A;  4KL1 A;  5LP6 B;  2YC0 A;  4BR6 A;  1H2S B;  1ROP A;  3TET A;  1AJN A;  5FPO A;  4FIP C;  1SC5 B;  1VQM V;  1K7D A;  3JAS B;  3C3S A;  4F6R B;  4FM1 A;  3L9D A;  5CMU A;  2R70 A;  1L0L H;  3WG7 C;  4KXR A;  3M8A A;  4JI4 O;  3G4S V;  5E1A C;  5KHG A;  3CC4 V;  3CRR A;  1N32 B;  4GUN A;  3R65 A;  1V54 B;  4DK0 A;  1W2B U;  2CAZ C;  4RUF A;  3ETG A;  3RVZ A;  2UUA B;  1N32 O;  5EIB C;  3CD6 V;  2RJZ A;  1AP5 A;  1H2N A;  3RW0 A;  5H6Q A;  4MVM A;  4EEQ A;  1KMI Z;  2UXD O;  2VS0 A;  5DN6 G;  2BSK B;  1SZX A;  4X1K B;  1V9P A;  1F7Y A;  1Q3E A;  1XL6 A;  4IIJ B;  1XI1 A;  1HDJ A;  1NH2 B;  5JWP A;  2XND G;  3E22 A;  3DC6 A;  1Z2G A;  4JYB A;  1RM1 C;  2W0X A;  4J11 A;  3BVO A;  3SYC A;  2EJR A;  5EK0 A;  2FTK A;  1WB7 A;  2V4D A;  2EIL C;  3UM7 A;  1SES A;  3E22 B;  2LGQ A;  2P22 C;  3AG1 C;  3ZMS A;  2E76 B;  2A79 B;  1ZL8 A;  3TJT A;  4O2B A;  4PDR A;  1JOY A;  1IX9 A;  3DTU B;  1Q8I A;  2CTP A;  3CCQ V;  2MW2 B;  2ETN A;  5LOV B;  5IYD O;  4ZOL B;  2Q9L A;  4MS2 A;  2RN9 A;  3OGI B;  2JGD B;  1IBM B;  4IT5 A;  5BXZ A;  1ZL8 B;  5KUK A;  2ZIM A;  5BR8 O;  4X65 B;  2QE7 G;  4XBF A;  3CCL V;  2F4V O;  4O4J B;  1K73 W;  5IWA O;  1M57 C;  3VQV A;  1D5N A;  2QR4 A;  4IL6 Z;  2LW7 A;  3CXC U;  2YIC A;  3OTF A;  3STL C;  2JR7 A;  4GX5 A;  1F23 A;  1HNX O;  3RN4 A;  2OWO A;  1S5L Z;  4DV4 O;  1KKD A;  4LFA O;  4I7Z B;  3RBZ A;  2Q7G A;  2CGO A;  3L71 H;  1HNX B;  5CA1 A;  1GMG A;  3TK1 A;  3JD3 A;  4ASU G;  4JAS A;  3K59 A;  1WB8 A;  4PEL A;  2ZXW B;  4DV5 B;  4UCU A;  1ORQ C;  4LF8 O;  5JVD B;  1OJH A;  3ZS8 C;  4DR2 O;  4DR5 B;  4DV1 B;  1Q43 A;  4GX2 A;  1AB3 A;  2Q69 A;  4I50 A;  1B3Q A;  1N8R W;  1RP3 B;  3LDE A;  3CJH B;  3TCU A;  3WU2 Z;  1XEQ A;  5B1A B;  1N34 O;  2BTO A;  5BZB A;  3A2F A;  4FLT A;  4DV2 O;  5LMU O;  4TV8 B;  2Q4P A;  2N74 A;  1IBK B;  4TT3 G;  1N34 B;  3ZN0 A;  4LCU C;  4B3M O;  3HKC A;  3HB3 B;  1BSM A;  3SR2 C;  1N36 O;  3AG7 A;  3ZJZ A;  1Q81 W;  1PNK A;  2W0F C;  1MSD A;  1VEW A;  1AR5 A;  3ZMT A;  3ZHV A;  4DV6 B;  4KUM A;  3FYI B;  1R73 A;  1AJQ A;  1WN7 A;  1VIB A;  1YIT V;  1WP8 A;  2PGG A;  2RMK B;  4JYA O;  1WLE A;  4DW1 A;  4RQE A;  1HNW O;  3HKB A;  5IYB O;  1XDC A;  4UVB A;  3EFF K;  3DGE A;  1QLE B;  4X1I B;  1O9G A;  2RDC A;  2LW1 A;  4CH4 A;  3CCM V;  1SQQ H;  1ZTE A;  4I9Q A;  3JAL B;  2DYS C;  5JJJ B;  3A0B Z;  2VQE O;  4IIJ A;  1RSO B;  1M5I A;  2LJ2 A;  1QR9 A;  2X0L A;  3QVN A;  1H38 A;  1VQ5 V;  3CE2 A;  5LHG A;  5J9P C;  3UO2 A;  4DR4 B;  3A0H Z;  4JTA B;  1SA0 A;  3ABM B;  1SF9 A;  1YVW A;  3ICX A;  4RWU A;  1K5Q A;  4PA3 A;  1Z5V A;  4CC6 A;  5IE9 A;  1SRY A;  5K1X A;  4YIO A;  2B5U A;  1TVK A;  2AXT Z;  3SPH A;  2EIJ B;  2XAQ A;  1UFI A;  1PPJ H;  1N4C A;  4U7N A;  3ZX6 A;  4J41 A;  4PA6 A;  2K1E A;  5AG2 A;  2ARH A;  4XDJ A;  3AEI A;  5BMV B;  4OGQ B;  2EUL A;  5IJ0 A;  2HVJ C;  4A5U B;  1SER A;  3E89 A;  1HNW B;  1K97 A;  3E8H A;  1GK9 A;  2H3O A;  2IBZ H;  4UVC A;  2VWK A;  1GM9 A;  1FKA O;  1DGS A;  3DSQ A;  4HNA B;  4PI2 A;  2N05 A;  3SYP A;  4WCE V;  4LF6 O;  4KHP B;  2DQ0 A;  1CP9 A;  5KHH A;  1M90 W;  4LFC O;  4D4O A;  4O4J A;  4DYL A;  1MZF A;  3IC7 A;  2AZ2 A;  1QLN A;  3RVY A;  3BCC H;  4DR3 B;  4X88 A;  3ABK C;  3AK2 A;  3GVM A;  3I55 V;  4PD4 F;  1KB9 F;  1R6K A;  4UCO A;  2NN4 A;  3T1H B;  2C2A A;  1XIL A;  2P5O A;  5J2U A;  3CPW U;  1OHH G;  4P9O A;  4PHZ A;  2BSK A;  2X6C A;  3JD2 A;  2YEV A;  1BHB A;  4TUY B;  2MK3 A;  1NZ6 A;  4HZ3 A;  2BOC C;  1LR1 A;  2PI4 A;  2DYR B;  5JQG A;  1VP7 A;  4GKJ O;  1KP3 A;  2FL4 A;  1YJN V;  5EC1 C;  1PL0 A;  4DV1 O;  5LXT B;  2ITD C;  3G80 A;  2PYL A;  3B2E E;  1SQP H;  3OM3 B;  1PD3 A;  4O4H B;  3W7X A;  4B3R B;  2UXC O;  4OX9 O;  1BQZ A;  1EFR G;  5FL7 G;  5IDJ A;  2Q67 A;  1MSW D;  4IHJ A;  3BA9 A;  4Q6G A;  4I0X A;  3JAT A;  5DEC A;  3LNM B;  1N36 B;  1AR4 A;  3O65 A;  1FFX A;  2UXD B;  4IYH A;  4O4H A;  1LNQ A;  4DR1 O;  4DV6 O;  3H1H H;  1BGY H;  1W59 A;  4DV4 B;  3T1H O;  2ZCE A;  5LGT A;  2QTO A;  2ZNJ A;  2IJK A;  2LP7 A;  1OZ0 A;  3CCV V;  3H1L H;  2UUC B;  4PA9 A;  4X62 O;  1JCH A;  3JAT B;  4U7O A;  1JQ0 A;  4XDL A;  2YIB D;  1JX9 A;  4X1K A;  2YDE A;  1URF A;  3K0G A;  4DR2 B;  3OGC C;  3JD0 A;  2W6I G;  2CGN A;  2HHH B;  4I55 B;  4BW9 A;  5KA5 A;  5EZY B;  5A9G A;  3SPG A;  1PM9 A;  3RFR A;  3CHX A;  1EZV H;  3ML0 A;  3UQ8 A;  1N33 O;  4GT1 A;  4KFM A;  1M9N A;  1AI4 A;  4DRX A;  2R9A A;  5B1N A;  1XMO B;  1RFY A;  1VQ8 V;  3ZHU A;  3LSQ A;  3BRC A;  4MVS A;  4F4L A;  2NNU A;  1F4N A;  4DV0 B;  1J5E O;  2XAH A;  3WB2 A;  3GB7 C;  4X66 B;  1I94 B;  4YJ3 A;  1Y6X A;  4H37 A;  1RM1 B;  1H2K A;  2HFE C;  4FM2 A;  1CXZ B;  5IWA B;  4L87 A;  3OR7 C;  4JI6 B;  1XOU A;  2F95 B;  5C8Y A;  4NXM O;  3DC5 A;  1GAX A;  4JI6 O;  4H13 B;  5CBF A;  3K9S A;  1R3I C;  4R6Z A;  5BMV A;  4PI0 A;  5IJ0 B;  2AHZ A;  2HEP A;  2CE4 A;  2P4K A;  3APQ A;  4J9Y B;  4TV9 A;  4FJC C;  3SGI A;  5B1B C;  1P4R A;  1Y4M A;  4UCV A;  2A9H A;  2WLI B;  2VQF O;  2ZIN A;  1V54 C;  1FS0 G;  2XTA A;  4MSW C;  1IVS A;  1P7B A;  1YF2 A;  4OXS A;  2A3Q A;  1XNR O;  4TQD A;  3I5D A;  1Y67 A;  4QPK A;  4LF9 O;  2B1I A;  2LO1 A;  2F66 C;  5LYJ B;  3RYI A;  4I4T A;  1OCZ B;  1Q5O A;  3DXR A;  2EIN C;  4I50 B;  4JTC B;  4WFF A;  1D2D A;  2QA4 V;  1QR8 A;  2H94 A;  2ZR2 A;  3B40 A;  4U3J A;  1L1F A;  2HJF C;  2QGN A;  4PA7 A;  1Q6H A;  3W7T A;  2QEX V;  3QO8 A;  5EYP A;  5L3C A;  3D36 C;  2UUB B;  2BTQ A;  2XOK G;  3K79 A;  1VQK V;  2OCH A;  3ZRW B;  3ABK B;  4BAY A;  3HKD B;  2UXC B;  4UXN A;  4CBC A;  2UU9 O;  5LMN O;  3A8T A;  1AP6 A;  1KKC A;  4FLV A;  4B7K A;  1R3J C;  2WLK A;  4ICG A;  1J95 A;  1WA8 A;  3CCU V;  3J80 N;  1S76 D;  1GM8 A;  5D5P A;  5JH7 A;  4R50 A;  5H6R A;  1EZJ A;  4LWS B;  4OPH A;  4X89 A;  1YOP A;  3K08 A;  1VQ7 V;  3K5L A;  3BAA A;  3E8F A;  4EB6 B;  2A7W A;  5KMG A;  4X62 B;  1G6U A;  2P7T C;  2KSD A;  1R6N A;  5B66 Z;  4RUE A;  4TSF G;  5GON B;  1I08 A;  4JZG A;  1EM1 A;  3C90 A;  4LBE C;  1Z5W A;  1OCR B;  5K1P A;  1K9M W;  2HJD A;  3JAW B;  2WLM A;  2JDI G;  4DUY O;  2NR5 A;  1M56 C;  1AIL A;  1BQ0 A;  2UUC O;  2XUM A;  3D8C A;  2O57 A;  4JAV A;  2F93 B;  4TV9 B;  4XDK A;  2A06 H;  4RO2 A;  3OAA G;  2QM8 A;  2ZE8 A;  3L72 H;  4QJF B;  3HPL C;  4X1Y A;  4LNU B;  3GWK C;  3SJC C;  3QNE A;  3SYA A;  5KAI Z;  5LXT A;  1DK1 A;  4J7K A;  5C93 A;  4UV8 A;  4JAA A;  4QGP A;  1KP2 A;  4JI2 B;  1KQS U;  2JJ1 G;  2OIE A;  1NR1 A;  4LNU A;  3CMA V;  4X65 O;  4HAM A;  2OIG A;  1JFF A;  2EIL B;  4OPA A;  3AK1 A;  3BEH A;  5LGU A;  2IJJ A;  2QJ1 A;  4JI7 B;  3CME V;  1JVM A;  3ZRX A;  2NLJ C;  1NT2 B;  2HP8 A;  1JA8 A;  1E79 G;  4UUJ C;  1YCI A;  4DR1 B;  2IM9 A;  2Q68 A;  2IH1 C;  4Z1V A;  2IJI A;  2CH7 A;  1OCO C;  1SA0 B;  1HR0 O;  1WPX A;  4FK5 C;  2Q0O C;  1FYJ A;  4NXN O;  4X20 B;  3CCJ V;  2Q8V A;  2FYU H;  3B4S A;  4CH3 A;  5LMN B;  4GX1 A;  2Y69 C;  3JAS A;  1NR7 A;  2BOB C;  1K4D C;  1PP9 H;  2Y0P A;  1YHQ V;  1BCC H;  1Q86 W;  1LUW A;  3H1K H;  1BZK A;  1SS3 A;  1GTO A;  5IY5 C;  5IJ9 B;  3RWR D;  4NXM B;  3L74 H;  2E75 B;  1K3E A;  5EZY A;  3ZMU A;  3WG7 B;  3CXH F;  1KBH A;  4ZKI A;  2OTL V;  2IJH A;  2Q7E A;  1JMK C;  4N23 A;  5LA6 A;  2KG7 B;  4O2B B;  3ZHS A;  1O9H A;  1HWY A;  1S5J A;  1VMG A;  1XMQ O;  1Y66 A; 
#chains in the Genus database with same CATH homology
 2YUA A;  2L6L A;  4X33 A;  1XBL A;  1WJZ A;  2QWO B;  1BQZ A;  2CTW A;  2OCH A;  2M6Y A;  1WGE A;  2DMX A;  4J7Z A;  2LGW A;  2JR7 A;  2CTR A;  2QWN B;  1N4C A;  3AG7 A;  3APO A;  1IUR A;  5AX2 A;  4IT5 A;  2CUG A;  2GUZ A;  4D4P A;  3UO2 A;  1YOP A;  1YWS A;  2GUZ B;  2QSA A;  2N05 A;  2DN9 A;  2Y4T A;  1FAF A;  3UCS C;  2N04 A;  3BVO A;  1BQ0 A;  2QWP B;  2CTQ A;  1FPO A;  4RWU A;  2PF4 E;  2YS8 A;  3UO3 A;  1GH6 A;  2CTP A;  2KQX A;  4D4O A;  1NZ6 A;  2QWR B;  4J80 A;  3APQ A;  2QWQ B;  1HDJ A;  2LO1 A;  2Y4U A;  2EJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...