2L6LA

Solution structure of human j-protein co-chaperone, dph4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
b'MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYNHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 24
publication title Solution structure of human J-protein cochaperone Dph4
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF05207 zf-CSL CSL zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2l6lA01
3.10.660.10 Alpha Beta Roll Microbial ribonuclease fold DPH Zinc finger 2l6lA02
2EJ7A 1BQZA 2PF4E 5AX2A 4RWUA 2GUZA 2OCHA 2CTRA 3AG7A 1FAFA 2CTPA 2Y4UA 1YOPA 2Y4TA 2YS8A 1NZ6A 2CUGA 1IURA 2QWQB 1FPOA 2YUAA 4X33A 1GH6A 4J7ZA 1XBLA 1HDJA 3APQA 4J80A 4D4PA 1YWSA 3BVOA 2L6LA 2QWNB 2GUZB 1WGEA 2LO1A 2QWRB 1WJZA 2QWOB 2N05A 3UCSC 2M6YA 2JR7A 1N4CA 3UO2A 4IT5A 2DN9A 2KQXA 4D4OA 2LGWA 2CTWA 2QWPB 3APOA 2QSAA 1BQ0A 3UO3A 2DMXA 2N04A 2CTQA
chains in the Genus database with same CATH superfamily
3ZRXA 4HBNA 3SYQA 2UXDO 2Q69A 1KECA 2W0FC 4XDJA 4BIUA 4UXNA 1AJNA 1JX9A 3HKDA 2EIKC 4LCUC 4JYAB 2QR4A 2FTKA 4I0XA 3M7MX 1RSOB 3K04A 1N34B 5C93A 4B3MO 4LFCB 4B08A 1M93A 5L3BA 2EIJC 3JAKB 1TA8A 4LF5O 4DYLA 4DRXA 5EYPB 4J42A 4O2BA 4B3SO 2EINB 4PJ0Z 2CUGA 4HAMA 4G28B 1RM1B 5LHIA 4JI7O 3CYOA 4UCOA 2GDSA 5B3SB 5JJEB 1OCRC 4XDLA 5JVDB 3RFRA 2JDIG 4ZKIA 3K57A 2RMKB 1ZL8A 2XT9A 1JJOA 3BA9A 3BRCA 1AR1B 4DUYO 4TUYA 1GO3F 5LHHA 4PI2A 1WP8A 1VQNV 3L9DA 1KC8W 4DR7B 4DR5O 3CRAA 4O4LA 4X1IB 2EBOA 3ETGA 3ICXA 1UPGA 5F2VO 1HNWB 1I5XA 4WFBV 3OMNB 4YJ2B 1LNQA 5BZBA 1Y66A 1S3JA 3OUFA 4KL1A 1M9NA 4CH3A 4YJ3B 1M56B 3K59A 5H5NA 1FXKB 2QSAA 3FD9A 3UO3A 2HEPA 1N0JA 2UXCB 4X1YB 4FK5C 2BTOA 1RSOA 2ITCC 1EZVH 4DUZB 4J41A 4K35A 2WAMA 2L6LA 1OCOC 3JAKA 2HLDG 5EYPA 2UXBB 1B3QA 5EBLC 2QA4V 2QKSA 3Q4HB 3DXRB 3JALB 2UUAO 5JVDA 4X33A 4OPHA 3BY6A 4QE7A 2AHYA 2DYSB 1X4TA 3W7TA 3CMEV 2IU0A 3G71V 1PL4A 4UCVA 4ASUG 4UCSA 1BCCH 1CEZA 4UCUA 5IYCO 4NTXA 2KB1A 4GX2A 1J95A 2VWJA 3K03A 2ZXWC 4X1IA 1MZFA 2E76B 2PTMA 3ABLC 1MSDA 4BIOA 3R65A 1PPJH 3JCZA 2Y0IA 4D4OA 1NS1A 4YJ2A 3H1JH 3F7YC 1K73W 1Q86W 4HNAA 4I50B 1HNZB 4YJ3A 2H3OA 1Q7YW 4NVPA 1MG1A 3K0GA 1FXKA 5KHIA 4MVOA 1HP8A 4GKKB 2WLLB 3F5TA 4LBEC 3OAAG 4I4TA 3FKSG 2UU9B 5H6RA 5B66Z 3WU2Z 1US6A 3E83A 1I0HA 5GTHZ 1Q90D 1TUBA 5B1NA 2QKAA 3I55V 1K3EA 1ZX3A 3ABTA 4LFBO 4DV4B 4JI1O 1SZTA 3CXCU 1FYJA 3HKEB 1SA0B 4WFAV 3OMAB 2HVKC 5B1OA 4J80A 4DV5O 2GTAA 5BMVB 3DC5A 3Q4HA 3BFRA 4YIPA 1WPBA 1R3KC 2FMLA 4PDLA 4BIZA 1ZUQA 4X8AA 4O4HB 2Q4PA 4FZ1A 1RPOA 3ETQA 1M57B 5KLVH 2ETNA 1R6TA 5H6QA 4YY3O 4ZHQB 1XHZA 1ZSPA 5KHJA 4JPRA 3ABUA 2JS5A 4JI5B 3SJAC 3MD0A 5IJ0B 2EZPA 1PKXA 2JIZG 2E3CA 3K0DA 3D3QA 1QBZA 1P49A 1CPYA 2ZR3A 2P90A 1GK9A 2KG7A 1IDSA 2ZE8A 4JAAA 1K34A 5LOVB 2NN4A 2YXYA 3ZBHA 4ZOLB 1MSWD 5D5PA 5HFMA 3ZRWA 4AILC 2A7WA 2BOBC 4W4LA 4FLYA 1XDCA 3HKBB 4FFBB 4GUNA 4L8JA 1XUQA 4NXMO 1GM7A 3WB2A 5J2UA 1AJPA 4IHJB 4UFZA 3LSSA 1JR9A 4JZGA 2JEUA 2ZNIA 2EIJB 3A0RA 3SPGA 5GONA 3T1YB 1MA1A 3BAAA 3E2EA 3DGEA 2AZ0A 3HKEA 1XOUA 5CB4B 2QEXV 3CEIA 3JAMN 2F4VB 1QU7A 1OCRB 1XMQO 3RYHB 1WN7A 5BMVA 5IWAO 3CXHF 3OFNG 2YS8A 1YSCA 2OT5A 5L3DA 1SQGA 4EB6A 4O4HA 1WGEA 4FZ0A 2LO1A 2JGDB 4TV8B 5FL7G 4I55A 4OGQB 1YTFB 4MVZA 3CRCA 3E8HA 4F6RA 5GW7A 1Y74B 3ZHQA 3ZMTA 3LDDA 3K5LA 2YIDA 1W59A 3CCJV 1NR1A 2X6AA 4FLXA 3JSLA 3JSNA 4ZI7B 1JMKC 4B7KA 3JAWB 2E5LB 2XASA 2QE7G 3L72H 2JRIA 3N2KB 2AHZA 4LF9B 3D36C 2DW4A 2YI9A 3CB2A 3LSUA 3JATB 1F51A 4PDMA 4MTFA 4DR6B 2YXHA 3CCVV 1L8DA 4TT3G 3OEHG 3ASNC 3WFVA 3HKBA 4FFBA 2JS3A 2ARHA 4LH6A 3TK1A 4BWAA 2YI8A 4IHJA 2RCVA 4EKWA 1Y76B 2AGAA 5EIBC 4TQFA 4J7JA 4GYCB 1Q43A 3H1LH 1PL0A 3JD2A 3JD0A 2UUBO 4LF6O 4ICGA 3J81N 1AROP 3P32A 1VARA 4I7ZB 1H2NA 5B5EZ 3RYFB 1NH2D 5EBWC 1VF5B 2HVJC 5CB4A 4O4JA 1NJIW 1HDJA 1YDXA 4FM2A 4JI2B 1XL4A 3UKMA 1X59A 4IL6Z 1Y6XA 4DK1A 2P7TC 4BAYA 4X88A 3K06A 4CH5A 1VQ9V 3IAYA 1FJGB 2AW9A 2CH7B 4W4KA 3L71H 2Q8VA 2EJ7A 1M4UA 4P9OA 4IYHA 5GTIZ 2JJ1G 1WPXA 2JGDA 3VOUA 3U11A 3CCMV 1DK1A 4TV8A 3SYCA 2ZINA 4X20B 1Z5VA 1Y74A 5DECA 5J2TB 2JVDA 1KUQA 3ZS8C 1NBMG 2ZXWB 1N34O 1RPRA 4RO2A 1S5LZ 4LFCO 4Q20A 5LA6B 4ZI7A 2LW1A 3JAWA 5IT9N 1BQZA 3OEEG 4MTXA 4WBNB 3B4SA 4XDKA 1SZXA 1BZKA 5IYZA 1NTMH 3UO2A 4GX0A 5FPOA 1EM1A 2IM9A 2QM7A 1IXBA 3KKYA 5L3FA 2FB5A 3HB3B 3EHBB 4UB8Z 1B06A 5B1BC 3ASOB 3QG5A 4A5UB 2F93B 4DR7O 4U3FH 3RYFA 4PD4F 1VQ4V 2WLNA 3JD4A 5KUKA 2BTQB 4FLWA 2CK3G 1HNWO 2CH7A 2DJVA 1IBKB 4JI8B 1G4YB 3K9AA 4JI0B 4PELA 3IGAC 4K0KB 1XILA 1N36B 2DE0X 5LP6A 1NVPB 3ZMSA 2P06A 2CE4A 3SPHA 1YF2A 1H2SB 4MVMA 1AB3A 2DQ3A 3QNEA 2UXCO 3SPIA 5J2TA 2GUZA 4JI3B 4MS2A 4CH6A 1BL8A 4G27B 1YHQV 1FPOA 1XREA 2PI4A 3S3WA 5LA6A 3CSXA 4PA9A 4KXRA 1L1FA 3SR2C 2BE3A 2QTOA 3D8CA 1WB7A 2FL4A 2F95B 2UXBO 1VQKV 2C2AA 2F43G 4TV9B 4DR4B 5K1PA 1ZAUA 4MTOA 3CC2V 1VQ5V 2WA4A 2LQTA 2Q7GA 3DC6A 5CBFA 1OZ0A 4FM1A 4RUEA 1ROPA 1VIBA 4CS3A 4OXSA 5AG2A 4JASA 1N8RW 1G6UA 3L70H 4ABMA 4YHHB 3H1HH 4FFKA 2E74B 1AP5A 1N4CA 2ZDIC 3FX7A 1YCIA 2YEVB 2QTSA 1NT2B 2B1GA 3ZMUA 1TVKB 3SJCC 4DV0O 2XAJA 2XAQA 3AK1A 3LDCA 1VQMV 3SYAA 1FS0G 4CS2A 4GKJB 4DO2A 5IDJA 4O2AB 4AI8A 2P4KA 4X89A 1N32O 5DEDA 2WLIA 1OV9A 2UXNA 2LFSA 3L73H 5AX2A 2GV9A 1HNZO 1S77D 2F66C 1FXHA 2W0XA 3H9VA 2B1IA 3KZIZ 3FYEB 4PA6A 5C8YB 1XBLA 3ZMZA 5JQGB 1K8AW 4GKKO 4QIWF 3VQVA 4X62B 3GVMA 4MT8A 3RBZA 1EFRG 1CXZB 1R3LC 3QO8A 1GTOA 1IZ3A 3BHPA 4NKGB 4X65B 4DR2B 4MW3A 4DV4O 1SQFA 4QPJA 2CTPA 3ZHSA 1IURA 1PP9H 4TV9A 1B04A 1LR1A 4DV7B 3E8BA 2YC0A 5KAFZ 1KU9A 1MMMA 3ASNB 2QWRB 2PYLA 4D6TH 3T1HB 2OWOA 1VQOV 1WAZA 5LXTB 4EFBA 1JCHA 3I56V 5HFLA 4RUFA 1MABG 2M7WA 2WLMA 5KX5B 1Z5WA 1G8MA 1H2LA 1R3JC 5IYBO 2OIGA 4H0LB 1TUEB 3TETA 2AZ2A 4UVAA 4JAUA 2RNBA 4B7EA 1H2KA 1TVKA 3BPZA 4AHCA 4JI5O 3U0ZA 4LF4B 4PDVA 4J10A 2DOSA 4KHPB 3JASB 2RJZA 1Q81W 1F4NA 3T4ZA 2EIMB 2Q7EA 1XMOO 1AVMA 3H01A 1DF4A 2LW7A 1YITV 1AJQA 1VQ7V 4DW0A 2QWPB 4R8CA 4UVBA 3K9SA 5JQGA 1D5NA 1P7BA 1VF6C 3SYPA 4ZBMA 1GRJA 2FYUH 1T5EA 1EN4A 4JGSA 1RP3B 3D3IA 4X1KB 3BA8A 3D36A 3T1YO 3DTUB 4P30A 4DV6O 2OTLV 4B3MB 4KP4A 5JH7B 3K58A 4DV3B 2A06H 4LH7A 4WFHA 1HWYA 1Q6HA 4X64B 3N2GB 1QLNA 2F4VO 3L74H 3VQWA 1F23A 1E1RG 3AEIA 2QGNA 5LXTA 2OCCB 1AI4A 2HJFC 1DGSA 4RQFA 1L0LH 3THOA 5FNVB 4X1YA 2JR7A 3JARB 4AQYB 5B1BB 4NYKA 5EZYB 3OM3B 1HW7A 1H8EG 3QO5A 1QVGU 3SPCA 2QJ1A 3ASOC 3F7VC 1FFTB 1YWSA 1K7DA 1WP7A 4FLZA 1M1KW 3MDSA 2VWKA 3J7AU 2ATKC 1BT8A 4DR5B 4JYBA 3HPLC 3DXRA 1YXBA 3JALA 2Q0AA 1EN6A 2LGQA 1KBHA 2B9ZA 4DR6O 1MOFA 4RWUA 2Q67A 1GN3A 1VEWA 1BS3A 1IBMB 3ZIAG 5IYDO 4GX5A 2N05A 1QCEA 3CRRA 2Q7HA 2P5OA 3APOA 2PYJA 4X1KA 3LUTB 1VQLV 5CA0B 3ML0A 1KB9F 4H37A 2QDOA 3ABMB 1NKDA 4DR1B 4DV2O 4TSFG 3K5OA 4JI2O 3FB5C 4X66O 2OIEA 3N2GA 3HKCB 1I7FA 3A8TA 4I50A 4JAVA 2XOKG 1FJGO 2LGWA 1HNXB 4P9PA 1FKAO 2WLLA 4GCZA 1XQ8A 3JARA 4TOIA 4E4EA 5LBQA 5EZYA 4PA7A 3RWRD 1K4DC 1O9HA 1KP2A 4WCEV 3W7WA 4MVQA 3CMAV 5CN0A 5JJJB 4K8ZA 1SA0A 3G80A 3G4SV 2ILMA 1O9GA 2HFEC 3IC7A 3SDLA 4O4IB 4JZ2A 2ITDC 2Y4UA 1OHHG 3X2QC 2QWQB 2B5UA 5BXZA 1QVFU 2RQ6A 2K1EA 5JCOC 1YJ9V 2YSUB 4Z1VA 1R3IC 3CD6V 3OW2U 1THZA 3P3NA 1URFA 3PJSK 4U3JB 5EBMC 1J5EO 3AG4C 3G6BA 2A9HA 3FB6C 2CAZC 1Q6UA 4DV1B 4ZHQA 2G38A 3MHSC 2ZE6A 5B1AC 3HR0A 4Z2WA 3ZHVA 5A2QN 2ZE7A 4GX1A 4QNHB 2E75B 5IJ0A 1NTKH 2A79B 4IIJB 2X6BA 1AI6A 2Q6AA 1VP7A 5A9GA 4JI6B 2P6JA 4TQDA 4OX9O 4LWSB 5LOVA 4K8XA 3G67A 3CPWU 3NR7A 5DM6V 3HKCA 4ZOLA 3A0HZ 1BGYH 2HG5C 4NTWA 1IBKO 1YTFD 4CS4A 4JI8O 4R7CA 4JI0O 3ETDA 3E89A 4K0KO 1N36O 2ZDIA 2P67A 2Y69B 5BR8B 3ETEA 1Q82W 2YICA 1MNGA 4I9QA 3CCLV 3FB8C 4DK0A 1ORQC 3OR7C 2Z5UA 4J7KA 2X6CA 5LMUO 2IJJA 3C90A 4UVCA 2DWEC 4O4IA 1DTOA 3OGCC 3RYHA 4JI4O 1BHBA 3K5MA 1N33B 2NLJC 2DMXA 4DR4O 1TAEA 2EIMC 3OE7G 2D3OW 3CRQA 3SYOA 2DYRC 1QQCA 3AG3C 4FLUA 4YHHO 4JYAO 1XEQA 4JYCA 1K97A 3OT7A 2LFRA 2WA3A 1QLEC 3RGBA 1G1XB 4LF7B 4IIJA 3CX5F 2CTRA 1TGOA 3N2KA 3ZHUA 2F1MA 3JATA 4NXNB 2NNUA 1KP3A 3FFQA 2Y48A 3FAVB 4FPPA 4GKJO 2JK5C 1AI7A 1V9PA 1OCZC 3W7XA 4CC6A 2UUCB 5IY5C 4H13B 2OCCC 4HYOA 3LSQA 5L3EA 5EK0A 3ZHRA 1Y76A 3ZCCA 3E86A 3EFFK 3ABKC 4WF9V 4PHZA 3O65A 4X62O 2QM4A 4H44B 4J11A 2D2CB 2HHHB 3CCQV 2R72A 1XI1A 2KQXA 3QF7A 3ZHTA 1OCCC 1GN4A 3HKDB 4B3TB 3WB0A 4MVRA 4DR2O 4MSWC 2N74A 4LP8A 2X0LA 2ZKOA 3ZX6A 3L75H 4NB5A 4RAIA 2Z0AA 1GKFA 3B8NA 3CS5A 4LC1A 4DRXB 4LF8B 2YIAA 1IX9A 3VBBA 3T1HO 1Q3EA 1SQVH 3TJTA 3E8GA 1VF6A 1PNMA 4X20A 1AILA 3JCUZ 4QPKA 5D5QA 5KHHA 1YJWV 4FM0A 2RDCA 3DSQA 3RT3C 1I5YA 1SETA 1IBLB 2Q0OC 2YUAA 2ZM6B 4DUZO 2IW5A 2WLJA 1ZL8B 4JV5B 1GMGA 3CRMA 2QWOB 1GN6A 4DR3B 4TUYB 5EC2C 4LF4O 4WBNA 5BY1A 1JA8A 2EILC 2ADQB 3ABMC 4R6ZA 2N04A 5CA1B 4KHPO 1BSMA 3FAVA 3RVZA 3KCXA 4DXWA 3CE2A 2FKXA 1LUVA 4C7UA 1WNSA 2Y0PA 1S5HC 1VQ8V 1IXMA 4FVMA 3CC7V 2EZOA 3E22B 3OR6C 1AI5A 2P4VA 3BCCH 3RYCB 2W6IG 2VQEB 1B6QA 3GWOA 1DF5A 2Z3YA 5L3GA 2PI5A 1A32A 1KYOF 3AG7A 2YIBA 3K08A 4KUMA 2PUSA 3BVOA 3QTCA 2VQFB 3X2QB 1YI2V 3E35A 2BTQA 4DV3O 2XTAA 1VF7A 4X64O 3CCUV 1EBOA 3M99B 4UV9A 3AG4B 2IU3A 3B8MA 3KG2A 1FAFA 3K3WA 4WFEA 1JOYA 4I9WA 1R6KA 1GH6A 1KKCA 1XNQB 4HZ3A 2IH3C 5B1AB 1XNRB 2L35A 2UU9O 1HR0B 4AQYO 5FPRA 2PGGA 2GTSA 1VMGA 2OTJV 2ZIOA 3W7SA 3FB7C 2A3QA 4LFAB 1W0KG 4MTGA 1XHXA 2HKOA 2MK3A 4MW8A 4FIPC 5CA1A 1Y67A 1SQBH 2XHBA 4EFEA 2CDYA 3ZRVA 1QHTA 3TXSA 2HJDA 3BABA 2P22C 1VQ6V 1BQ0A 4Z1MG 2ZQMA 1P4RA 3RYIB 1H38A 5LHGA 3E22A 1XL6A 3W7UA 4U7OA 1NZ6A 2WPDG 3RYCA 3TXQA 1JFFB 2YEVA 4HNAB 4MVSA 3WG7C 3OTOB 5CBHA 2Y69C 1IBMO 4FMTA 1N0NA 1PD3A 3OUSA 2V4DA 1VQPV 3KCYA 2HP8A 4B3RB 4PDRA 4I4TB 1I94B 4TWKA 4DR1O 4O2AA 3AK2A 1BHAA 1TUBB 5JCOA 5LMNB 1M5IA 3B77A 2EULA 4P2ZA 2R9RB 4NTYA 5JJNB 5EIBD 2DYRB 1PNLA 3AG3B 5LL6Y 1SRYA 1HNXO 5C8YA 3B09A 2UXDB 4UCRA 2PF4E 1QLEB 3UT5B 4EEQA 3H1KH 3CWBH 3FYIB 3QO7A 1OJHA 1KQSU 4NR1A 1AP6A 4I5SA 1WJZA 1K92A 5LP6C 4U7NA 5E79Z 1DLBA 4JF3A 2WSSG 2JGUA 5CA3A 5E1AC 3B2EE 5KA6A 4LF5B 4DV0B 4B3SB 1ZLZA 3CP1A 1KKDA 1OCZB 1V55C 5IY5B 3P3PA 1Q8IA 3MHHC 4JI7B 2XAGA 2RN9A 3RYIA 3CJHB 1K5SA 2KG7B 5KHGA 3JYCA 4OPAA 2ODMA 1BE3H 3ABKB 5KX5A 3AG1C 2YXLA 1AR4A 1N32B 2XAFA 1WA8B 1SESA 3B40A 1JFFA 4DV1O 1NQTA 5H2FZ 1K4CC 3ZRWB 3EXAA 4DW1A 3OTFA 3SGIA 1OCCB 3G6EV 4DUYB 1KD1W 1JPXA 3SPJA 3STZC 5J2UB 5CMUA 4IYIA 1P84F 3JASA 2E5LO 1GAXA 1M90W 1V54C 4PI0A 1U97A 4LF9O 5CBGA 4JI6O 2M6YA 1U96A 2H8PC 5KA5A 2A0LA 2KKWA 2IJKA 4F6EA 3QVNA 5GONB 3ZMVA 1S0VA 3H1IH 1K33A 4GZRB 4J9ZB 3MAQA 3RN4A 2F23A 2EX3A 2OYQA 2DWDC 1IVSA 3TGUH 3TCUA 3APQA 2GSMB 2XUMA 4GLXA 2BSKB 1ZWIC 2Q9LA 3UT5A 3J80N 2LP7A 2DN9A 1Z2GA 5BR8O 3F5WC 3EVKA 3LNMB 1WB8A 4EB6B 3ZN1A 2W6JG 4D7SA 4N21A 2EILB 4I55B 1BMFG 3T2MA 4BW5A 4F6RB 5JH7A 3AG2C 1Q6IA 2LJ2A 3ZEDA 1RFYA 3NXSA 1EZJA 4LNUB 3K5NA 1N33O 2KSDA 1SF9A 2CTWA 1PV0A 4UB6Z 4IGGA 1SQXH 2QWNB 2ZD9A 4D7TA 1LUWA 1S5JA 4UV8A 3CJHA 5LYJB 2UUAB 3K79A 5FNVA 1XMOB 4JYYA 1WA8A 1GM8A 1K5QA 2ZT9B 2EIKB 4LF7O 3BEHA 1UFIA 4BR6A 1E79G 3A0BZ 2OCHA 3ZN0A 2Y4TA 1NU1H 1H2MA 4J7ZA 3R66A 4NXNO 4D4PA 5KMGB 2ZE5A 1Q5OA 2V1DA 4DV6B 3UM7A 1YZBA 1S72V 5ITZB 2MW2B 4O4JB 1D2DA 2O57A 2EINC 2CTQA 2UUCO 2BSKA 1RM1C 1QR9A 3CHXA 1YEWA 5B3SC 4J9YB 4QJFB 3GWKC 4E2LA 1R6NA 1SC5B 5LGUA 2BOCC 2ZCEA 5CA0A 2CGNA 4YXWG 1FD9A 2HHHO 5K1XA 3JD3A 3S3XA 2QKCA 1SS3A 4QGPA 4B3TO 3VQYA 2VRZA 1JVMA 2DQ0A 4CH4A 1SQPH 4LFBB 3O9OA 4JI1B 1FFXB 1YOPA 4LNUA 2H94A 3E8FA 3N27A 4QE9A 1YJNV 4FJCC 4FLTA 4DV5B 5IE9A 4LF8O 1NH2B 2JEXA 3M8AA 5LYJA 3VQXA 3WG7B 2R9IA 4ZIBA 1K9MW 2Q68A 5IYZB 2AXTZ 1P7GA 4JI3O 5JWPA 5J9PC 1IBLO 2ZM6O 2Q5ZA 4YY3B 3CCEV 2V7QG 1M56C 5KHKA 1FXKC 4JV5O 4K3AA 4WFFA 1R73A 5LGTA 1NI8A 4DR3O 4F4LA 4IT5A 1OCOB 1NTZH 5IJ9B 5KMGA 3OMIB 2XAHA 2NR5A 3C3SA 3SJQC 4DV2B 3IJ4A 1H8HG 4U3JA 5ITZA 4UCTA 4X66B 2WLKA 5KAIZ 1COWG 1I08A 4BW9A 3UCSC 4G2KA 2Q73A 2VQEO 1FXVA 4RQEA 3GB7C 4NXMB 3WB1A 5LP6B 1CP9A 3RVYA 3UQ8A 3T4DA 4JTCB 1ZTEA 4XBFA 1SERA 4R50A 1F7YA 5TISZ 2DYSC 4LWSA 3ZRSA 2UXXA 5FLXN 2VQFO 2GUZB 3I5DA 1V55B 1YIJV 4JTDB 5LGNA 1R1BA 1FFXA 3U10A 3ABLB 4MVUA 2YDEA 3T1CA 3CCRV 3RW0A 2JJ2G 1EN5A 2R70A 2IJIA 1XMQB 3AG1B 5KUMA 5IWAB 1KMIZ 4GT1A 3LNNA 5L3CA 2PZSA 3IC9A 1XNQO 1ENVA 1XNRO 1QR8A 2IH1C 2VS0A 3AK3A 1SQQH 1GN2A 2K9PA 1AR5A 4X9QA 3CC4V 1J5EB 1HR0O 4KFMA 3ZJZA 1W0JG 2XNDG 2PY5A 3PN1A 1V54B 3SJBC 4UUJC 2EJRA 2ZR2A 1H2GA 2IJHA 4I0XB 1SKVA 4CZZA 4X65O 1QNMA 4H33A 4LFAO 4JTAB 4N23A 4L87A 1MZEA 5IJ9A 1Y4MA 2CGOA 3CCSV 4DV7O 1PM9A 3OGIB 2HR3A 4O2BB 2WWWA 1F4MA 4OX9B 2ZNJA 2BCCH 1E1QG 4CBCA 2QM8A 2GHYA 1UJWB 3OD4A 2WLIB 2YIBD 4YIOA 1D5AA 2GBOA 3STLC 3OTOO 3AG2B 2WLHA 5H9CA 3IFXA 2ZIMA 4Q6GA 4PA4A 2UUBB 4LF6B 1M57C 4B3RO 2IBZH 5DN6G 1I94O 1W2BU 4FLVA 2X7RB 2R9AA 4LR3A 4O4LB 3LDEA 5LMNO 5LMUB 1NVPD 4WFGA 1NR7A 3A2FA 1S76D 1L0NH 4PA3A 3C3TA 3JD1A 4CC5A 4JI4B 1YVWA 4PV1B 1JQ0A 2ADPA 3P30A 1PNKA 1GM9A 1WLEA 5EC1C 1JJ2U
chains in the Genus database with same CATH topology
2EJ7A 1BQZA 2PF4E 5AX2A 4RWUA 2GUZA 2OCHA 2CTRA 3AG7A 1FAFA 2CTPA 2Y4UA 1YOPA 2Y4TA 2YS8A 1NZ6A 2CUGA 1IURA 2QWQB 1FPOA 2YUAA 4X33A 1GH6A 4J7ZA 1XBLA 1HDJA 3APQA 4J80A 4D4PA 1YWSA 3BVOA 2L6LA 2QWNB 2GUZB 1WGEA 2LO1A 2QWRB 1WJZA 2QWOB 2N05A 3UCSC 2M6YA 2JR7A 1N4CA 3UO2A 4IT5A 2DN9A 2KQXA 4D4OA 2LGWA 2CTWA 2QWPB 3APOA 2QSAA 1BQ0A 3UO3A 2DMXA 2N04A 2CTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ7 A;  1BQZ A;  2PF4 E;  5AX2 A;  4RWU A;  2GUZ A;  2OCH A;  2CTR A;  3AG7 A;  1FAF A;  2CTP A;  2Y4U A;  1YOP A;  2Y4T A;  2YS8 A;  1NZ6 A;  2CUG A;  1IUR A;  2QWQ B;  1FPO A;  2YUA A;  4X33 A;  1GH6 A;  4J7Z A;  1XBL A;  1HDJ A;  3APQ A;  4J80 A;  4D4P A;  1YWS A;  3BVO A;  2L6L A;  2QWN B;  2GUZ B;  1WGE A;  2LO1 A;  2QWR B;  1WJZ A;  2QWO B;  2N05 A;  3UCS C;  2M6Y A;  2JR7 A;  1N4C A;  3UO2 A;  4IT5 A;  2DN9 A;  2KQX A;  4D4O A;  2LGW A;  2CTW A;  2QWP B;  3APO A;  2QSA A;  1BQ0 A;  3UO3 A;  2DMX A;  2N04 A;  2CTQ A; 
#chains in the Genus database with same CATH topology
 3ZRX A;  4HBN A;  3SYQ A;  2UXD O;  2Q69 A;  1KEC A;  2W0F C;  4XDJ A;  4BIU A;  4UXN A;  1AJN A;  1JX9 A;  3HKD A;  2EIK C;  4LCU C;  4JYA B;  2QR4 A;  2FTK A;  4I0X A;  3M7M X;  1RSO B;  3K04 A;  1N34 B;  5C93 A;  4B3M O;  4LFC B;  4B08 A;  1M93 A;  5L3B A;  2EIJ C;  3JAK B;  1TA8 A;  4LF5 O;  4DYL A;  4DRX A;  5EYP B;  4J42 A;  4O2B A;  4B3S O;  2EIN B;  4PJ0 Z;  2CUG A;  4HAM A;  4G28 B;  1RM1 B;  5LHI A;  4JI7 O;  3CYO A;  4UCO A;  2GDS A;  5B3S B;  5JJE B;  1OCR C;  4XDL A;  5JVD B;  3RFR A;  2JDI G;  4ZKI A;  3K57 A;  2RMK B;  1ZL8 A;  2XT9 A;  1JJO A;  3BA9 A;  3BRC A;  1AR1 B;  4DUY O;  4TUY A;  1GO3 F;  5LHH A;  4PI2 A;  1WP8 A;  1VQN V;  3L9D A;  1KC8 W;  4DR7 B;  4DR5 O;  3CRA A;  4O4L A;  4X1I B;  2EBO A;  3ETG A;  3ICX A;  1UPG A;  5F2V O;  1HNW B;  1I5X A;  4WFB V;  3OMN B;  4YJ2 B;  1LNQ A;  5BZB A;  1Y66 A;  1S3J A;  3OUF A;  4KL1 A;  1M9N A;  4CH3 A;  4YJ3 B;  1M56 B;  3K59 A;  5H5N A;  1FXK B;  2QSA A;  3FD9 A;  3UO3 A;  2HEP A;  1N0J A;  2UXC B;  4X1Y B;  4FK5 C;  2BTO A;  1RSO A;  2ITC C;  1EZV H;  4DUZ B;  4J41 A;  4K35 A;  2WAM A;  2L6L A;  1OCO C;  3JAK A;  2HLD G;  5EYP A;  2UXB B;  1B3Q A;  5EBL C;  2QA4 V;  2QKS A;  3Q4H B;  3DXR B;  3JAL B;  2UUA O;  5JVD A;  4X33 A;  4OPH A;  3BY6 A;  4QE7 A;  2AHY A;  2DYS B;  1X4T A;  3W7T A;  3CME V;  2IU0 A;  3G71 V;  1PL4 A;  4UCV A;  4ASU G;  4UCS A;  1BCC H;  1CEZ A;  4UCU A;  5IYC O;  4NTX A;  2KB1 A;  4GX2 A;  1J95 A;  2VWJ A;  3K03 A;  2ZXW C;  4X1I A;  1MZF A;  2E76 B;  2PTM A;  3ABL C;  1MSD A;  4BIO A;  3R65 A;  1PPJ H;  3JCZ A;  2Y0I A;  4D4O A;  1NS1 A;  4YJ2 A;  3H1J H;  3F7Y C;  1K73 W;  1Q86 W;  4HNA A;  4I50 B;  1HNZ B;  4YJ3 A;  2H3O A;  1Q7Y W;  4NVP A;  1MG1 A;  3K0G A;  1FXK A;  5KHI A;  4MVO A;  1HP8 A;  4GKK B;  2WLL B;  3F5T A;  4LBE C;  3OAA G;  4I4T A;  3FKS G;  2UU9 B;  5H6R A;  5B66 Z;  3WU2 Z;  1US6 A;  3E83 A;  1I0H A;  5GTH Z;  1Q90 D;  1TUB A;  5B1N A;  2QKA A;  3I55 V;  1K3E A;  1ZX3 A;  3ABT A;  4LFB O;  4DV4 B;  4JI1 O;  1SZT A;  3CXC U;  1FYJ A;  3HKE B;  1SA0 B;  4WFA V;  3OMA B;  2HVK C;  5B1O A;  4J80 A;  4DV5 O;  2GTA A;  5BMV B;  3DC5 A;  3Q4H A;  3BFR A;  4YIP A;  1WPB A;  1R3K C;  2FML A;  4PDL A;  4BIZ A;  1ZUQ A;  4X8A A;  4O4H B;  2Q4P A;  4FZ1 A;  1RPO A;  3ETQ A;  1M57 B;  5KLV H;  2ETN A;  1R6T A;  5H6Q A;  4YY3 O;  4ZHQ B;  1XHZ A;  1ZSP A;  5KHJ A;  4JPR A;  3ABU A;  2JS5 A;  4JI5 B;  3SJA C;  3MD0 A;  5IJ0 B;  2EZP A;  1PKX A;  2JIZ G;  2E3C A;  3K0D A;  3D3Q A;  1QBZ A;  1P49 A;  1CPY A;  2ZR3 A;  2P90 A;  1GK9 A;  2KG7 A;  1IDS A;  2ZE8 A;  4JAA A;  1K34 A;  5LOV B;  2NN4 A;  2YXY A;  3ZBH A;  4ZOL B;  1MSW D;  5D5P A;  5HFM A;  3ZRW A;  4AIL C;  2A7W A;  2BOB C;  4W4L A;  4FLY A;  1XDC A;  3HKB B;  4FFB B;  4GUN A;  4L8J A;  1XUQ A;  4NXM O;  1GM7 A;  3WB2 A;  5J2U A;  1AJP A;  4IHJ B;  4UFZ A;  3LSS A;  1JR9 A;  4JZG A;  2JEU A;  2ZNI A;  2EIJ B;  3A0R A;  3SPG A;  5GON A;  3T1Y B;  1MA1 A;  3BAA A;  3E2E A;  3DGE A;  2AZ0 A;  3HKE A;  1XOU A;  5CB4 B;  2QEX V;  3CEI A;  3JAM N;  2F4V B;  1QU7 A;  1OCR B;  1XMQ O;  3RYH B;  1WN7 A;  5BMV A;  5IWA O;  3CXH F;  3OFN G;  2YS8 A;  1YSC A;  2OT5 A;  5L3D A;  1SQG A;  4EB6 A;  4O4H A;  1WGE A;  4FZ0 A;  2LO1 A;  2JGD B;  4TV8 B;  5FL7 G;  4I55 A;  4OGQ B;  1YTF B;  4MVZ A;  3CRC A;  3E8H A;  4F6R A;  5GW7 A;  1Y74 B;  3ZHQ A;  3ZMT A;  3LDD A;  3K5L A;  2YID A;  1W59 A;  3CCJ V;  1NR1 A;  2X6A A;  4FLX A;  3JSL A;  3JSN A;  4ZI7 B;  1JMK C;  4B7K A;  3JAW B;  2E5L B;  2XAS A;  2QE7 G;  3L72 H;  2JRI A;  3N2K B;  2AHZ A;  4LF9 B;  3D36 C;  2DW4 A;  2YI9 A;  3CB2 A;  3LSU A;  3JAT B;  1F51 A;  4PDM A;  4MTF A;  4DR6 B;  2YXH A;  3CCV V;  1L8D A;  4TT3 G;  3OEH G;  3ASN C;  3WFV A;  3HKB A;  4FFB A;  2JS3 A;  2ARH A;  4LH6 A;  3TK1 A;  4BWA A;  2YI8 A;  4IHJ A;  2RCV A;  4EKW A;  1Y76 B;  2AGA A;  5EIB C;  4TQF A;  4J7J A;  4GYC B;  1Q43 A;  3H1L H;  1PL0 A;  3JD2 A;  3JD0 A;  2UUB O;  4LF6 O;  4ICG A;  3J81 N;  1ARO P;  3P32 A;  1VAR A;  4I7Z B;  1H2N A;  5B5E Z;  3RYF B;  1NH2 D;  5EBW C;  1VF5 B;  2HVJ C;  5CB4 A;  4O4J A;  1NJI W;  1HDJ A;  1YDX A;  4FM2 A;  4JI2 B;  1XL4 A;  3UKM A;  1X59 A;  4IL6 Z;  1Y6X A;  4DK1 A;  2P7T C;  4BAY A;  4X88 A;  3K06 A;  4CH5 A;  1VQ9 V;  3IAY A;  1FJG B;  2AW9 A;  2CH7 B;  4W4K A;  3L71 H;  2Q8V A;  2EJ7 A;  1M4U A;  4P9O A;  4IYH A;  5GTI Z;  2JJ1 G;  1WPX A;  2JGD A;  3VOU A;  3U11 A;  3CCM V;  1DK1 A;  4TV8 A;  3SYC A;  2ZIN A;  4X20 B;  1Z5V A;  1Y74 A;  5DEC A;  5J2T B;  2JVD A;  1KUQ A;  3ZS8 C;  1NBM G;  2ZXW B;  1N34 O;  1RPR A;  4RO2 A;  1S5L Z;  4LFC O;  4Q20 A;  5LA6 B;  4ZI7 A;  2LW1 A;  3JAW A;  5IT9 N;  1BQZ A;  3OEE G;  4MTX A;  4WBN B;  3B4S A;  4XDK A;  1SZX A;  1BZK A;  5IYZ A;  1NTM H;  3UO2 A;  4GX0 A;  5FPO A;  1EM1 A;  2IM9 A;  2QM7 A;  1IXB A;  3KKY A;  5L3F A;  2FB5 A;  3HB3 B;  3EHB B;  4UB8 Z;  1B06 A;  5B1B C;  3ASO B;  3QG5 A;  4A5U B;  2F93 B;  4DR7 O;  4U3F H;  3RYF A;  4PD4 F;  1VQ4 V;  2WLN A;  3JD4 A;  5KUK A;  2BTQ B;  4FLW A;  2CK3 G;  1HNW O;  2CH7 A;  2DJV A;  1IBK B;  4JI8 B;  1G4Y B;  3K9A A;  4JI0 B;  4PEL A;  3IGA C;  4K0K B;  1XIL A;  1N36 B;  2DE0 X;  5LP6 A;  1NVP B;  3ZMS A;  2P06 A;  2CE4 A;  3SPH A;  1YF2 A;  1H2S B;  4MVM A;  1AB3 A;  2DQ3 A;  3QNE A;  2UXC O;  3SPI A;  5J2T A;  2GUZ A;  4JI3 B;  4MS2 A;  4CH6 A;  1BL8 A;  4G27 B;  1YHQ V;  1FPO A;  1XRE A;  2PI4 A;  3S3W A;  5LA6 A;  3CSX A;  4PA9 A;  4KXR A;  1L1F A;  3SR2 C;  2BE3 A;  2QTO A;  3D8C A;  1WB7 A;  2FL4 A;  2F95 B;  2UXB O;  1VQK V;  2C2A A;  2F43 G;  4TV9 B;  4DR4 B;  5K1P A;  1ZAU A;  4MTO A;  3CC2 V;  1VQ5 V;  2WA4 A;  2LQT A;  2Q7G A;  3DC6 A;  5CBF A;  1OZ0 A;  4FM1 A;  4RUE A;  1ROP A;  1VIB A;  4CS3 A;  4OXS A;  5AG2 A;  4JAS A;  1N8R W;  1G6U A;  3L70 H;  4ABM A;  4YHH B;  3H1H H;  4FFK A;  2E74 B;  1AP5 A;  1N4C A;  2ZDI C;  3FX7 A;  1YCI A;  2YEV B;  2QTS A;  1NT2 B;  2B1G A;  3ZMU A;  1TVK B;  3SJC C;  4DV0 O;  2XAJ A;  2XAQ A;  3AK1 A;  3LDC A;  1VQM V;  3SYA A;  1FS0 G;  4CS2 A;  4GKJ B;  4DO2 A;  5IDJ A;  4O2A B;  4AI8 A;  2P4K A;  4X89 A;  1N32 O;  5DED A;  2WLI A;  1OV9 A;  2UXN A;  2LFS A;  3L73 H;  5AX2 A;  2GV9 A;  1HNZ O;  1S77 D;  2F66 C;  1FXH A;  2W0X A;  3H9V A;  2B1I A;  3KZI Z;  3FYE B;  4PA6 A;  5C8Y B;  1XBL A;  3ZMZ A;  5JQG B;  1K8A W;  4GKK O;  4QIW F;  3VQV A;  4X62 B;  3GVM A;  4MT8 A;  3RBZ A;  1EFR G;  1CXZ B;  1R3L C;  3QO8 A;  1GTO A;  1IZ3 A;  3BHP A;  4NKG B;  4X65 B;  4DR2 B;  4MW3 A;  4DV4 O;  1SQF A;  4QPJ A;  2CTP A;  3ZHS A;  1IUR A;  1PP9 H;  4TV9 A;  1B04 A;  1LR1 A;  4DV7 B;  3E8B A;  2YC0 A;  5KAF Z;  1KU9 A;  1MMM A;  3ASN B;  2QWR B;  2PYL A;  4D6T H;  3T1H B;  2OWO A;  1VQO V;  1WAZ A;  5LXT B;  4EFB A;  1JCH A;  3I56 V;  5HFL A;  4RUF A;  1MAB G;  2M7W A;  2WLM A;  5KX5 B;  1Z5W A;  1G8M A;  1H2L A;  1R3J C;  5IYB O;  2OIG A;  4H0L B;  1TUE B;  3TET A;  2AZ2 A;  4UVA A;  4JAU A;  2RNB A;  4B7E A;  1H2K A;  1TVK A;  3BPZ A;  4AHC A;  4JI5 O;  3U0Z A;  4LF4 B;  4PDV A;  4J10 A;  2DOS A;  4KHP B;  3JAS B;  2RJZ A;  1Q81 W;  1F4N A;  3T4Z A;  2EIM B;  2Q7E A;  1XMO O;  1AVM A;  3H01 A;  1DF4 A;  2LW7 A;  1YIT V;  1AJQ A;  1VQ7 V;  4DW0 A;  2QWP B;  4R8C A;  4UVB A;  3K9S A;  5JQG A;  1D5N A;  1P7B A;  1VF6 C;  3SYP A;  4ZBM A;  1GRJ A;  2FYU H;  1T5E A;  1EN4 A;  4JGS A;  1RP3 B;  3D3I A;  4X1K B;  3BA8 A;  3D36 A;  3T1Y O;  3DTU B;  4P30 A;  4DV6 O;  2OTL V;  4B3M B;  4KP4 A;  5JH7 B;  3K58 A;  4DV3 B;  2A06 H;  4LH7 A;  4WFH A;  1HWY A;  1Q6H A;  4X64 B;  3N2G B;  1QLN A;  2F4V O;  3L74 H;  3VQW A;  1F23 A;  1E1R G;  3AEI A;  2QGN A;  5LXT A;  2OCC B;  1AI4 A;  2HJF C;  1DGS A;  4RQF A;  1L0L H;  3THO A;  5FNV B;  4X1Y A;  2JR7 A;  3JAR B;  4AQY B;  5B1B B;  4NYK A;  5EZY B;  3OM3 B;  1HW7 A;  1H8E G;  3QO5 A;  1QVG U;  3SPC A;  2QJ1 A;  3ASO C;  3F7V C;  1FFT B;  1YWS A;  1K7D A;  1WP7 A;  4FLZ A;  1M1K W;  3MDS A;  2VWK A;  3J7A U;  2ATK C;  1BT8 A;  4DR5 B;  4JYB A;  3HPL C;  3DXR A;  1YXB A;  3JAL A;  2Q0A A;  1EN6 A;  2LGQ A;  1KBH A;  2B9Z A;  4DR6 O;  1MOF A;  4RWU A;  2Q67 A;  1GN3 A;  1VEW A;  1BS3 A;  1IBM B;  3ZIA G;  5IYD O;  4GX5 A;  2N05 A;  1QCE A;  3CRR A;  2Q7H A;  2P5O A;  3APO A;  2PYJ A;  4X1K A;  3LUT B;  1VQL V;  5CA0 B;  3ML0 A;  1KB9 F;  4H37 A;  2QDO A;  3ABM B;  1NKD A;  4DR1 B;  4DV2 O;  4TSF G;  3K5O A;  4JI2 O;  3FB5 C;  4X66 O;  2OIE A;  3N2G A;  3HKC B;  1I7F A;  3A8T A;  4I50 A;  4JAV A;  2XOK G;  1FJG O;  2LGW A;  1HNX B;  4P9P A;  1FKA O;  2WLL A;  4GCZ A;  1XQ8 A;  3JAR A;  4TOI A;  4E4E A;  5LBQ A;  5EZY A;  4PA7 A;  3RWR D;  1K4D C;  1O9H A;  1KP2 A;  4WCE V;  3W7W A;  4MVQ A;  3CMA V;  5CN0 A;  5JJJ B;  4K8Z A;  1SA0 A;  3G80 A;  3G4S V;  2ILM A;  1O9G A;  2HFE C;  3IC7 A;  3SDL A;  4O4I B;  4JZ2 A;  2ITD C;  2Y4U A;  1OHH G;  3X2Q C;  2QWQ B;  2B5U A;  5BXZ A;  1QVF U;  2RQ6 A;  2K1E A;  5JCO C;  1YJ9 V;  2YSU B;  4Z1V A;  1R3I C;  3CD6 V;  3OW2 U;  1THZ A;  3P3N A;  1URF A;  3PJS K;  4U3J B;  5EBM C;  1J5E O;  3AG4 C;  3G6B A;  2A9H A;  3FB6 C;  2CAZ C;  1Q6U A;  4DV1 B;  4ZHQ A;  2G38 A;  3MHS C;  2ZE6 A;  5B1A C;  3HR0 A;  4Z2W A;  3ZHV A;  5A2Q N;  2ZE7 A;  4GX1 A;  4QNH B;  2E75 B;  5IJ0 A;  1NTK H;  2A79 B;  4IIJ B;  2X6B A;  1AI6 A;  2Q6A A;  1VP7 A;  5A9G A;  4JI6 B;  2P6J A;  4TQD A;  4OX9 O;  4LWS B;  5LOV A;  4K8X A;  3G67 A;  3CPW U;  3NR7 A;  5DM6 V;  3HKC A;  4ZOL A;  3A0H Z;  1BGY H;  2HG5 C;  4NTW A;  1IBK O;  1YTF D;  4CS4 A;  4JI8 O;  4R7C A;  4JI0 O;  3ETD A;  3E89 A;  4K0K O;  1N36 O;  2ZDI A;  2P67 A;  2Y69 B;  5BR8 B;  3ETE A;  1Q82 W;  2YIC A;  1MNG A;  4I9Q A;  3CCL V;  3FB8 C;  4DK0 A;  1ORQ C;  3OR7 C;  2Z5U A;  4J7K A;  2X6C A;  5LMU O;  2IJJ A;  3C90 A;  4UVC A;  2DWE C;  4O4I A;  1DTO A;  3OGC C;  3RYH A;  4JI4 O;  1BHB A;  3K5M A;  1N33 B;  2NLJ C;  2DMX A;  4DR4 O;  1TAE A;  2EIM C;  3OE7 G;  2D3O W;  3CRQ A;  3SYO A;  2DYR C;  1QQC A;  3AG3 C;  4FLU A;  4YHH O;  4JYA O;  1XEQ A;  4JYC A;  1K97 A;  3OT7 A;  2LFR A;  2WA3 A;  1QLE C;  3RGB A;  1G1X B;  4LF7 B;  4IIJ A;  3CX5 F;  2CTR A;  1TGO A;  3N2K A;  3ZHU A;  2F1M A;  3JAT A;  4NXN B;  2NNU A;  1KP3 A;  3FFQ A;  2Y48 A;  3FAV B;  4FPP A;  4GKJ O;  2JK5 C;  1AI7 A;  1V9P A;  1OCZ C;  3W7X A;  4CC6 A;  2UUC B;  5IY5 C;  4H13 B;  2OCC C;  4HYO A;  3LSQ A;  5L3E A;  5EK0 A;  3ZHR A;  1Y76 A;  3ZCC A;  3E86 A;  3EFF K;  3ABK C;  4WF9 V;  4PHZ A;  3O65 A;  4X62 O;  2QM4 A;  4H44 B;  4J11 A;  2D2C B;  2HHH B;  3CCQ V;  2R72 A;  1XI1 A;  2KQX A;  3QF7 A;  3ZHT A;  1OCC C;  1GN4 A;  3HKD B;  4B3T B;  3WB0 A;  4MVR A;  4DR2 O;  4MSW C;  2N74 A;  4LP8 A;  2X0L A;  2ZKO A;  3ZX6 A;  3L75 H;  4NB5 A;  4RAI A;  2Z0A A;  1GKF A;  3B8N A;  3CS5 A;  4LC1 A;  4DRX B;  4LF8 B;  2YIA A;  1IX9 A;  3VBB A;  3T1H O;  1Q3E A;  1SQV H;  3TJT A;  3E8G A;  1VF6 A;  1PNM A;  4X20 A;  1AIL A;  3JCU Z;  4QPK A;  5D5Q A;  5KHH A;  1YJW V;  4FM0 A;  2RDC A;  3DSQ A;  3RT3 C;  1I5Y A;  1SET A;  1IBL B;  2Q0O C;  2YUA A;  2ZM6 B;  4DUZ O;  2IW5 A;  2WLJ A;  1ZL8 B;  4JV5 B;  1GMG A;  3CRM A;  2QWO B;  1GN6 A;  4DR3 B;  4TUY B;  5EC2 C;  4LF4 O;  4WBN A;  5BY1 A;  1JA8 A;  2EIL C;  2ADQ B;  3ABM C;  4R6Z A;  2N04 A;  5CA1 B;  4KHP O;  1BSM A;  3FAV A;  3RVZ A;  3KCX A;  4DXW A;  3CE2 A;  2FKX A;  1LUV A;  4C7U A;  1WNS A;  2Y0P A;  1S5H C;  1VQ8 V;  1IXM A;  4FVM A;  3CC7 V;  2EZO A;  3E22 B;  3OR6 C;  1AI5 A;  2P4V A;  3BCC H;  3RYC B;  2W6I G;  2VQE B;  1B6Q A;  3GWO A;  1DF5 A;  2Z3Y A;  5L3G A;  2PI5 A;  1A32 A;  1KYO F;  3AG7 A;  2YIB A;  3K08 A;  4KUM A;  2PUS A;  3BVO A;  3QTC A;  2VQF B;  3X2Q B;  1YI2 V;  3E35 A;  2BTQ A;  4DV3 O;  2XTA A;  1VF7 A;  4X64 O;  3CCU V;  1EBO A;  3M99 B;  4UV9 A;  3AG4 B;  2IU3 A;  3B8M A;  3KG2 A;  1FAF A;  3K3W A;  4WFE A;  1JOY A;  4I9W A;  1R6K A;  1GH6 A;  1KKC A;  1XNQ B;  4HZ3 A;  2IH3 C;  5B1A B;  1XNR B;  2L35 A;  2UU9 O;  1HR0 B;  4AQY O;  5FPR A;  2PGG A;  2GTS A;  1VMG A;  2OTJ V;  2ZIO A;  3W7S A;  3FB7 C;  2A3Q A;  4LFA B;  1W0K G;  4MTG A;  1XHX A;  2HKO A;  2MK3 A;  4MW8 A;  4FIP C;  5CA1 A;  1Y67 A;  1SQB H;  2XHB A;  4EFE A;  2CDY A;  3ZRV A;  1QHT A;  3TXS A;  2HJD A;  3BAB A;  2P22 C;  1VQ6 V;  1BQ0 A;  4Z1M G;  2ZQM A;  1P4R A;  3RYI B;  1H38 A;  5LHG A;  3E22 A;  1XL6 A;  3W7U A;  4U7O A;  1NZ6 A;  2WPD G;  3RYC A;  3TXQ A;  1JFF B;  2YEV A;  4HNA B;  4MVS A;  3WG7 C;  3OTO B;  5CBH A;  2Y69 C;  1IBM O;  4FMT A;  1N0N A;  1PD3 A;  3OUS A;  2V4D A;  1VQP V;  3KCY A;  2HP8 A;  4B3R B;  4PDR A;  4I4T B;  1I94 B;  4TWK A;  4DR1 O;  4O2A A;  3AK2 A;  1BHA A;  1TUB B;  5JCO A;  5LMN B;  1M5I A;  3B77 A;  2EUL A;  4P2Z A;  2R9R B;  4NTY A;  5JJN B;  5EIB D;  2DYR B;  1PNL A;  3AG3 B;  5LL6 Y;  1SRY A;  1HNX O;  5C8Y A;  3B09 A;  2UXD B;  4UCR A;  2PF4 E;  1QLE B;  3UT5 B;  4EEQ A;  3H1K H;  3CWB H;  3FYI B;  3QO7 A;  1OJH A;  1KQS U;  4NR1 A;  1AP6 A;  4I5S A;  1WJZ A;  1K92 A;  5LP6 C;  4U7N A;  5E79 Z;  1DLB A;  4JF3 A;  2WSS G;  2JGU A;  5CA3 A;  5E1A C;  3B2E E;  5KA6 A;  4LF5 B;  4DV0 B;  4B3S B;  1ZLZ A;  3CP1 A;  1KKD A;  1OCZ B;  1V55 C;  5IY5 B;  3P3P A;  1Q8I A;  3MHH C;  4JI7 B;  2XAG A;  2RN9 A;  3RYI A;  3CJH B;  1K5S A;  2KG7 B;  5KHG A;  3JYC A;  4OPA A;  2ODM A;  1BE3 H;  3ABK B;  5KX5 A;  3AG1 C;  2YXL A;  1AR4 A;  1N32 B;  2XAF A;  1WA8 B;  1SES A;  3B40 A;  1JFF A;  4DV1 O;  1NQT A;  5H2F Z;  1K4C C;  3ZRW B;  3EXA A;  4DW1 A;  3OTF A;  3SGI A;  1OCC B;  3G6E V;  4DUY B;  1KD1 W;  1JPX A;  3SPJ A;  3STZ C;  5J2U B;  5CMU A;  4IYI A;  1P84 F;  3JAS A;  2E5L O;  1GAX A;  1M90 W;  1V54 C;  4PI0 A;  1U97 A;  4LF9 O;  5CBG A;  4JI6 O;  2M6Y A;  1U96 A;  2H8P C;  5KA5 A;  2A0L A;  2KKW A;  2IJK A;  4F6E A;  3QVN A;  5GON B;  3ZMV A;  1S0V A;  3H1I H;  1K33 A;  4GZR B;  4J9Z B;  3MAQ A;  3RN4 A;  2F23 A;  2EX3 A;  2OYQ A;  2DWD C;  1IVS A;  3TGU H;  3TCU A;  3APQ A;  2GSM B;  2XUM A;  4GLX A;  2BSK B;  1ZWI C;  2Q9L A;  3UT5 A;  3J80 N;  2LP7 A;  2DN9 A;  1Z2G A;  5BR8 O;  3F5W C;  3EVK A;  3LNM B;  1WB8 A;  4EB6 B;  3ZN1 A;  2W6J G;  4D7S A;  4N21 A;  2EIL B;  4I55 B;  1BMF G;  3T2M A;  4BW5 A;  4F6R B;  5JH7 A;  3AG2 C;  1Q6I A;  2LJ2 A;  3ZED A;  1RFY A;  3NXS A;  1EZJ A;  4LNU B;  3K5N A;  1N33 O;  2KSD A;  1SF9 A;  2CTW A;  1PV0 A;  4UB6 Z;  4IGG A;  1SQX H;  2QWN B;  2ZD9 A;  4D7T A;  1LUW A;  1S5J A;  4UV8 A;  3CJH A;  5LYJ B;  2UUA B;  3K79 A;  5FNV A;  1XMO B;  4JYY A;  1WA8 A;  1GM8 A;  1K5Q A;  2ZT9 B;  2EIK B;  4LF7 O;  3BEH A;  1UFI A;  4BR6 A;  1E79 G;  3A0B Z;  2OCH A;  3ZN0 A;  2Y4T A;  1NU1 H;  1H2M A;  4J7Z A;  3R66 A;  4NXN O;  4D4P A;  5KMG B;  2ZE5 A;  1Q5O A;  2V1D A;  4DV6 B;  3UM7 A;  1YZB A;  1S72 V;  5ITZ B;  2MW2 B;  4O4J B;  1D2D A;  2O57 A;  2EIN C;  2CTQ A;  2UUC O;  2BSK A;  1RM1 C;  1QR9 A;  3CHX A;  1YEW A;  5B3S C;  4J9Y B;  4QJF B;  3GWK C;  4E2L A;  1R6N A;  1SC5 B;  5LGU A;  2BOC C;  2ZCE A;  5CA0 A;  2CGN A;  4YXW G;  1FD9 A;  2HHH O;  5K1X A;  3JD3 A;  3S3X A;  2QKC A;  1SS3 A;  4QGP A;  4B3T O;  3VQY A;  2VRZ A;  1JVM A;  2DQ0 A;  4CH4 A;  1SQP H;  4LFB B;  3O9O A;  4JI1 B;  1FFX B;  1YOP A;  4LNU A;  2H94 A;  3E8F A;  3N27 A;  4QE9 A;  1YJN V;  4FJC C;  4FLT A;  4DV5 B;  5IE9 A;  4LF8 O;  1NH2 B;  2JEX A;  3M8A A;  5LYJ A;  3VQX A;  3WG7 B;  2R9I A;  4ZIB A;  1K9M W;  2Q68 A;  5IYZ B;  2AXT Z;  1P7G A;  4JI3 O;  5JWP A;  5J9P C;  1IBL O;  2ZM6 O;  2Q5Z A;  4YY3 B;  3CCE V;  2V7Q G;  1M56 C;  5KHK A;  1FXK C;  4JV5 O;  4K3A A;  4WFF A;  1R73 A;  5LGT A;  1NI8 A;  4DR3 O;  4F4L A;  4IT5 A;  1OCO B;  1NTZ H;  5IJ9 B;  5KMG A;  3OMI B;  2XAH A;  2NR5 A;  3C3S A;  3SJQ C;  4DV2 B;  3IJ4 A;  1H8H G;  4U3J A;  5ITZ A;  4UCT A;  4X66 B;  2WLK A;  5KAI Z;  1COW G;  1I08 A;  4BW9 A;  3UCS C;  4G2K A;  2Q73 A;  2VQE O;  1FXV A;  4RQE A;  3GB7 C;  4NXM B;  3WB1 A;  5LP6 B;  1CP9 A;  3RVY A;  3UQ8 A;  3T4D A;  4JTC B;  1ZTE A;  4XBF A;  1SER A;  4R50 A;  1F7Y A;  5TIS Z;  2DYS C;  4LWS A;  3ZRS A;  2UXX A;  5FLX N;  2VQF O;  2GUZ B;  3I5D A;  1V55 B;  1YIJ V;  4JTD B;  5LGN A;  1R1B A;  1FFX A;  3U10 A;  3ABL B;  4MVU A;  2YDE A;  3T1C A;  3CCR V;  3RW0 A;  2JJ2 G;  1EN5 A;  2R70 A;  2IJI A;  1XMQ B;  3AG1 B;  5KUM A;  5IWA B;  1KMI Z;  4GT1 A;  3LNN A;  5L3C A;  2PZS A;  3IC9 A;  1XNQ O;  1ENV A;  1XNR O;  1QR8 A;  2IH1 C;  2VS0 A;  3AK3 A;  1SQQ H;  1GN2 A;  2K9P A;  1AR5 A;  4X9Q A;  3CC4 V;  1J5E B;  1HR0 O;  4KFM A;  3ZJZ A;  1W0J G;  2XND G;  2PY5 A;  3PN1 A;  1V54 B;  3SJB C;  4UUJ C;  2EJR A;  2ZR2 A;  1H2G A;  2IJH A;  4I0X B;  1SKV A;  4CZZ A;  4X65 O;  1QNM A;  4H33 A;  4LFA O;  4JTA B;  4N23 A;  4L87 A;  1MZE A;  5IJ9 A;  1Y4M A;  2CGO A;  3CCS V;  4DV7 O;  1PM9 A;  3OGI B;  2HR3 A;  4O2B B;  2WWW A;  1F4M A;  4OX9 B;  2ZNJ A;  2BCC H;  1E1Q G;  4CBC A;  2QM8 A;  2GHY A;  1UJW B;  3OD4 A;  2WLI B;  2YIB D;  4YIO A;  1D5A A;  2GBO A;  3STL C;  3OTO O;  3AG2 B;  2WLH A;  5H9C A;  3IFX A;  2ZIM A;  4Q6G A;  4PA4 A;  2UUB B;  4LF6 B;  1M57 C;  4B3R O;  2IBZ H;  5DN6 G;  1I94 O;  1W2B U;  4FLV A;  2X7R B;  2R9A A;  4LR3 A;  4O4L B;  3LDE A;  5LMN O;  5LMU B;  1NVP D;  4WFG A;  1NR7 A;  3A2F A;  1S76 D;  1L0N H;  4PA3 A;  3C3T A;  3JD1 A;  4CC5 A;  4JI4 B;  1YVW A;  4PV1 B;  1JQ0 A;  2ADP A;  3P30 A;  1PNK A;  1GM9 A;  1WLE A;  5EC1 C;  1JJ2 U; 
#chains in the Genus database with same CATH homology
 2EJ7 A;  1BQZ A;  2PF4 E;  5AX2 A;  4RWU A;  2GUZ A;  2OCH A;  2CTR A;  3AG7 A;  1FAF A;  2CTP A;  2Y4U A;  1YOP A;  2Y4T A;  2YS8 A;  1NZ6 A;  2CUG A;  1IUR A;  2QWQ B;  1FPO A;  2YUA A;  4X33 A;  1GH6 A;  4J7Z A;  1XBL A;  1HDJ A;  3APQ A;  4J80 A;  4D4P A;  1YWS A;  3BVO A;  2L6L A;  2QWN B;  2GUZ B;  1WGE A;  2LO1 A;  2QWR B;  1WJZ A;  2QWO B;  2N05 A;  3UCS C;  2M6Y A;  2JR7 A;  1N4C A;  3UO2 A;  4IT5 A;  2DN9 A;  2KQX A;  4D4O A;  2LGW A;  2CTW A;  2QWP B;  3APO A;  2QSA A;  1BQ0 A;  3UO3 A;  2DMX A;  2N04 A;  2CTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...