2L6LA

Solution structure of human j-protein co-chaperone, dph4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily C member 24
publication title Solution structure of human J-protein cochaperone Dph4
rcsb
source organism Homo sapiens
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF05207 zf-CSL CSL zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2l6lA01
3.10.660.10 Alpha Beta Roll Microbial ribonuclease fold DPH Zinc finger 2l6lA02
2EJ7A 1IURA 4D4OA 2CUGA 3APOA 4RWUA 1FAFA 3AG7A 2QWOB 2GUZA 4X33A 2CTWA 1YWSA 2JR7A 5AX2A 2QWNB 2CTQA 2LO1A 1WGEA 1XBLA 2CTPA 2OCHA 3UO2A 1YOPA 1GH6A 4D4PA 2DN9A 1BQ0A 2YS8A 2CTRA 2L6LA 2N05A 2Y4UA 1NZ6A 3APQA 1N4CA 2LGWA 2QWRB 2DMXA 2PF4E 2QSAA 1FPOA 2N04A 2QWQB 2QWPB 3BVOA 2KQXA 1WJZA 2GUZB 2YUAA 4IT5A 2M6YA 4J80A 3UCSC 1HDJA 4J7ZA 3UO3A 1BQZA 2Y4TA
chains in the Genus database with same CATH superfamily
5BMVB 1JX9A 4DR3O 2X0LA 4P2ZA 5F2VO 5KMGB 4Z1MG 2Y48A 3E22A 3RYCB 1O9HA 4O4LA 1GM9A 1ZAUA 1AP6A 2X6AA 4LF8B 3F5TA 4QGPA 3Q4HA 2GV9A 2IW5A 4R50A 3JARB 2PGGA 2ZIMA 5EBLC 2ZNIA 3ZRWA 4DV2O 1MA1A 3CCSV 4RWUA 3JATB 5JCOC 3W7WA 1R1BA 2HKOA 4DV4B 1WAZA 3A8TA 4LF5O 2QA4V 4LCUC 4FVMA 3STLC 1VARA 3ZEDA 5H2FZ 4JI4B 3JD1A 4FPPA 3JAWB 3HKBA 3VOUA 1YJNV 2CGNA 3H1HH 2GDSA 2AW9A 4DUYB 1Y74A 2LGQA 1NS1A 4CH3A 4YHHB 4LP8A 3AG1C 4DR4O 2ZDIA 2YDEA 4TQFA 1FFXB 5LGUA 3WG7C 1EN6A 3JASB 2WWWA 1RM1B 4DR5O 4DV7O 2QWRB 2R9RB 1QLNA 5K1XA 3MHSC 5B1BC 4LFBB 4BAYA 1XHXA 1M4UA 1SZTA 3NR7A 4JGSA 4HZ3A 4O4HB 2ZE6A 2JR7A 1Q81W 3SJBC 1EN4A 2K9PA 1I08A 4EB6B 4CS2A 2Y69C 3CSXA 2IJHA 1ZX3A 2LW1A 1MMMA 3FB6C 2EILC 1IXBA 4RO2A 1SQQH 3T4DA 1SKVA 3RW0A 3IFXA 3CMEV 4JI1B 1ROPA 4WBNB 4NKGB 2QWOB 1TUEB 2JGDB 5GONB 3T1HB 3J81N 3CCQV 2KG7A 3L73H 3T2MA 2BOCC 3H01A 5B66Z 1JFFA 2WLLB 2GTSA 4OPHA 1S5LZ 3OM3B 3K5MA 2HJFC 5IY5C 1EBOA 2Q7HA 3M99B 3RYIB 2YUAA 3JALA 2EJ7A 4JI7O 1QU7A 5L3EA 4I4TA 2P90A 3FAVB 3B40A 4O2AB 1NJIW 5DM6V 3ZHQA 4DW0A 3TETA 3OGIB 4DR2O 1XHZA 3UO2A 1L0LH 1F23A 2JRIA 1OCRC 2BTOA 2VQEO 3OR6C 1TGOA 1L0NH 1S77D 4AHCA 4EKWA 3K9AA 4JYYA 1N8RW 3G6EV 3EXAA 3RN4A 3WB1A 2EULA 2WA4A 2Y4TA 1I0HA 3CXCU 3CJHB 4FLUA 3BCCH 2UUCO 2R9AA 4CC5A 4K0KB 4CC6A 1AILA 4GX5A 5J2TA 3RYFA 4CH5A 1SESA 3LDCA 1BQ0A 4GKJO 4TT3G 4FLWA 5IDJA 1VQ5V 1NQTA 4NVPA 4DR7B 2DYRB 2HHHB 3AG3C 4GZRB 2WLNA 2FMLA 3ZHRA 4ZI7A 2AXTZ 2YXLA 3CD6V 1BGYH 3CC7V 3VQWA 3B4SA 2EBOA 3ZBHA 4EEQA 4CH4A 3WG7B 1Z5WA 5KHIA 1V55C 4JI8O 2PZSA 1VQOV 5B1BB 4B7EA 4J9YB 2F1MA 3K58A 2VQFB 2F23A 4JI0B 4PELA 4MW3A 3D3IA 4YXWG 3H9VA 2LP7A 5FNVB 1PNLA 1G1XB 1R3IC 3F7YC 3RYHA 1SQPH 4X65B 4DRXA 5IWAB 3DXRB 4DR1O 2EILB 1R3KC 5A9GA 1S72V 2L6LA 2OTJV 1IBMO 3RVYA 4PDMA 3SYAA 4WFEA 1MNGA 1KUQA 2DWEC 3IAYA 3SPIA 2HG5C 3E22B 4UCRA 1KP2A 4G28B 4I55B 4FM1A 1VMGA 5CB4A 4UCSA 1GTOA 1YVWA 3CCVV 3KG2A 2HR3A 1E79G 3Q4HB 3CMAV 5IJ0A 1HNWB 4FMTA 4X1KB 2WLJA 2RCVA 1AI4A 3QNEA 4D7TA 3AG4C 1FXKA 2XT9A 1KC8W 2H3OA 2RNBA 2ZE7A 1B6QA 2YI8A 1BCCH 3N2GA 4QE7A 2LFSA 1YWSA 2XAQA 1I7FA 4B3SO 4X64B 2IJIA 3S3WA 1ORQC 1BHBA 1W2BU 1OCRB 1PL0A 3HKBB 5B1NA 2UU9B 1Y6XA 1CPYA 1JPXA 3ASOC 5KHGA 1Y74B 3X2QB 2VRZA 2IJKA 1PM9A 3K04A 3IGAC 4IL6Z 4LH7A 1AB3A 3BRCA 4LF4O 5B3SC 3AG7A 4J7JA 2GTAA 1SERA 5CN0A 1UFIA 5K1PA 2E5LO 2PYJA 2YICA 2WLKA 3HKDA 3P3PA 4GCZA 2YI9A 4BW5A 5LP6A 3K59A 4DXWA 2UUAB 2OWOA 1U96A 5LHIA 3ZX6A 2QM7A 5LHHA 4JYAO 2N04A 3AG3B 2IU0A 4UV9A 5LL6Y 2PYLA 3JD3A 3ICXA 3ZMVA 4LF6O 1S0VA 3SJCC 1YTFB 3OR7C 2LQTA 1V55B 3LSUA 4MVUA 3O65A 2WLMA 1AI5A 4X8AA 5IYDO 1M90W 1IDSA 1R73A 1X4TA 5LMNB 2FTKA 4GT1A 2ZM6B 3OE7G 2IBZH 2KG7B 4ICGA 1HR0B 4DR6O 1JFFB 3DC6A 5BR8O 2OCHA 5BY1A 3CC4V 4JZ2A 1R3LC 3JALB 1HNZO 1QHTA 2UXDO 4I4TB 3FYEB 2HVKC 4I50A 3JYCA 3STZC 1ZLZA 3K06A 1DK1A 5H9CA 4BIUA 4J10A 2EX3A 3CC2V 1D5AA 5CBHA 3FB8C 1F7YA 1Q6UA 3OEHG 1K5QA 5AG2A 5EK0A 4UVBA 2F4VO 1XBLA 4K35A 4CZZA 1VEWA 1W0KG 1THZA 1WN7A 4LWSB 2C2AA 5LGTA 3T1YB 2XOKG 4KXRA 1XNQB 3AG4B 2AGAA 2QWPB 4PV1B 3OUFA 1N36O 1M1KW 1PKXA 2NNUA 1P84F 1M56B 4DV3B 5J2TB 3RYFB 4TUYA 1LUWA 4DV1O 4B3MB 2OT5A 2P6JA 1XILA 1IBLO 2OIGA 2CH7A 4PJ0Z 1H2GA 1WA8A 4ZI7B 2N05A 1NBMG 3T4ZA 3LDDA 4TV9A 2DE0X 3ASOB 4UV8A 4L8JA 1N32B 5LXTA 4NXMO 4JYAB 3RT3C 5IYZA 5B3SB 4DV5B 2E3CA 2H94A 4F6RB 2CTWA 1URFA 2CTQA 2BSKA 2ETNA 4MTXA 5LMUB 2WLHA 4DO2A 3I56V 4IYIA 3E89A 4RQFA 4PDRA 1GN6A 2PY5A 2EINB 2DYSB 3O9OA 3OTOB 2YC0A 4OPAA 3RWRD 1N0JA 1CEZA 3R66A 4WFFA 1VP7A 2P4VA 4Z1VA 3A2FA 4NTWA 4JYCA 4IYHA 4KUMA 4LF8O 3IC7A 3RVZA 1MSWD 5CB4B 4PI0A 4QPKA 4LR3A 1SQFA 5EYPB 1XI1A 2QKCA 3ABKC 4D6TH 2DWDC 4DV4O 1GAXA 1XUQA 1G8MA 5CA1B 1I94B 3AG2B 5EBMC 5H6QA 2FB5A 2F95B 5JH7A 4JI4O 4JI6B 1IBKO 3CB2A 4WF9V 2ATKC 3AK3A 3WFVA 1AVMA 1K5SA 4G2KA 1K4CC 3N2GB 3TCUA 2QEXV 3TGUH 4B08A 4CS3A 3OD4A 1OZ0A 2CE4A 4DUYO 3L70H 4YHHO 1VQ8V 4H13B 4JAUA 1RFYA 2OCCC 1R6NA 3AK2A 2QKAA 4UB6Z 2V4DA 1SQVH 1F4NA 3A0RA 3BVOA 1VF6C 1YIJV 4LFBO 1HWYA 3MAQA 1M9NA 1BT8A 3OEEG 2F66C 3HKDB 1MG1A 1WPBA 5JQGB 5LP6B 4OX9B 1MABG 1B04A 1F51A 2YEVA 1HW7A 2QJ1A 1KQSU 1VIBA 4I0XA 1XMQB 2AHZA 2QM8A 3B09A 1N34B 2W6JG 1VQ7V 2QWQB 4MVMA 4JAVA 2HJDA 2ZCEA 3CRRA 4JI1O 4FJCC 1ZWIC 4FLZA 3SPHA 3T1HO 2MW2B 3QO5A 2GUZA 5C8YA 4HNAA 4GX1A 1WP8A 2X6CA 4UCVA 4U7NA 3SJQC 3BABA 1QNMA 2LJ2A 2P67A 4MW8A 3GVMA 3N27A 3W7SA 5LHGA 3G67A 2Z0AA 3UO3A 4DYLA 5FPRA 1IURA 1FYJA 1RPOA 2QTOA 1YJWV 5GTIZ 1HNXB 2HFEC 3L71H 4I50B 3WU2Z 4J42A 1XOUA 5D5PA 1IBKB 3ABLB 3K79A 2LGWA 2EJRA 3SPGA 4B7KA 1M57C 2DYRC 3ABKB 3N2KA 2BTQB 3SR2C 2RQ6A 4UCTA 5B1AB 1P7GA 3KKYA 3D3QA 4K0KO 2H8PC 1I5YA 3ZRVA 3F7VC 4ZHQA 1YITV 3ETGA 1DF4A 1S5JA 1Y76A 2NR5A 1XQ8A 4DR7O 3CCJV 2HHHO 2Q4PA 4E4EA 3FB7C 3WB0A 2ODMA 4PDLA 1JJ2U 4FLTA 1JR9A 3IC9A 3CCLV 4FLVA 2OCCB 4B3RB 1WA8B 5AX2A 5DEDA 3VQYA 4RQEA 4MVRA 4TV9B 2OIEA 1WB8A 4R8CA 2HLDG 2Y4UA 5L3FA 3D8CA 5L3BA 3JD2A 2VQFO 2UXBB 5LYJB 1WJZA 4JI0O 3ZHSA 1OV9A 3FX7A 3QG5A 3BA8A 3K3WA 2LW7A 1F4MA 5J9PC 3M8AA 4AQYB 4OGQB 4X65O 5IWAO 4EFEA 1M5IA 4O2BB 1AROP 4J7KA 3BAAA 4JI3O 4QJFB 3ZJZA 3UKMA 2ZXWB 1BE3H 2WPDG 3I55V 4JPRA 1Q6IA 4D4OA 2CK3G 2IH3C 5A2QN 2DOSA 3G80A 1GM8A 1H38A 2JDIG 3K03A 1XL6A 1HNWO 5KHHA 1GH6A 5KA6A 4C7UA 1KKCA 1VQNV 5L3DA 3FD9A 1H8EG 3E35A 1NTZH 2XAGA 4J7ZA 1R6TA 3E8FA 3X2QC 3G6BA 2WAMA 1G6UA 2ZDIC 1R3JC 2B5UA 5JH7B 2R9IA 3PJSK 4X64O 2ZNJA 3U10A 4J41A 4NYKA 2UU9O 3IJ4A 3CCUV 1JJOA 3CRCA 1BSMA 4MVOA 1IZ3A 1E1QG 4ZKIA 3CE2A 1JMKC 1M57B 4N23A 3K5OA 4JTDB 3UT5A 5CBFA 4FFBB 1IXMA 3CHXA 1JA8A 1TA8A 4U3JA 3LNMB 2Y0IA 2UUAO 4QNHB 2WLIA 3CPWU 1T5EA 2JGUA 3OTFA 4NTXA 1M93A 4X1IA 2AZ0A 1FD9A 2YEVB 5CA0B 2O57A 4B3TB 4PHZA 1AR4A 4I0XB 3ZS8C 4JI2B 4NR1A 4IIJA 1RP3B 1NVPD 3HPLC 4I9WA 5LMNO 2IH1C 1FKAO 2GUZB 4JI3B 2ZM6O 2JEXA 1HR0O 1SA0A 1EZVH 1Q43A 4O4LB 5EC2C 3AK1A 3SYCA 3SJAC 3A0BZ 1GKFA 3J7AU 3ZRWB 5TISZ 4K3AA 4XDLA 1L1FA 3ZMTA 4PA3A 3SPCA 4KHPB 4J9ZB 2QKSA 1Q86W 1M56C 4X66B 3ZMUA 1US6A 2WA3A 3FFQA 1MSDA 1AJNA 4LFCB 3KCYA 3JD4A 2A79B 3T1YO 4JF3A 3N2KB 2CTRA 1XNQO 1KU9A 4HAMA 2XTAA 3CS5A 4ZBMA 4PD4F 4WFHA 3TJTA 3K08A 5KHKA 4FZ1A 4DV3O 1Q3EA 4ZHQB 4JTCB 4BWAA 4LFAB 2P7TC 4B3MO 1SQXH 4DUZB 2NLJC 3HKEA 3QTCA 4EFBA 2CDYA 2ZINA 1BHAA 1SQBH 3HR0A 1H2SB 2Q7EA 1WLEA 2Q8VA 5LA6A 1N32O 3ABTA 2WSSG 2LFRA 2R70A 3TXSA 3ZHTA 3TXQA 4DV5O 2FKXA 4UVCA 2EINC 1NH2D 2DYSC 2A7WA 2XUMA 3U11A 1CXZB 1Z2GA 1PPJH 5LMUO 2A0LA 2QTSA 2ZKOA 3ETDA 3K9SA 4ASUG 4UB8Z 4MT8A 2YIBA 1TVKA 3OTOO 3CRMA 1DGSA 1CP9A 1YSCA 5EZYA 3D36A 2DW4A 2AHYA 3FYIB 1WGEA 4BIZA 3OFNG 4DV6B 2D3OW 2F43G 1XDCA 3AG2C 1FXKC 2F93B 3QVNA 2XAFA 1W59A 4PDVA 2Y0PA 2GHYA 1TUBA 1AR1B 5KHJA 1K73W 1WB7A 5E79Z 2VS0A 3JARA 3CRAA 3J80N 1XNRB 3MHHC 1I94O 2YSUB 3ML0A 2LO1A 4H44B 4BIOA 4JI6O 3ZHUA 4Z2WA 5IYBO 3JD0A 3WB2A 1YHQV 3JAWA 4MTFA 5EBWC 1KECA 5LP6C 1SRYA 2DJVA 3L72H 4IGGA 5IJ9A 3OAAG 3ZN1A 1QCEA 4TOIA 3UT5B 3QF7A 4XDKA 2D2CB 4RUEA 1FFXA 1Q8IA 3KZIZ 3ZN0A 2Q73A 2YIAA 1JCHA 4U3JB 3JASA 4Q20A 3OT7A 4OX9O 3ZRSA 1Y66A 2WLIB 1W0JG 5IE9A 1D5NA 1GO3F 3ABMC 3K0DA 2UXCB 1XMQO 4X1IB 1I5XA 2FL4A 1N34O 4LF7B 1Q90D 2QSAA 3CYOA 4FM0A 2ADPA 2KSDA 4TQDA 4MSWC 2BE3A 4HYOA 1N33B 3RYHB 4DRXB 1YEWA 4IIJB 2QWNB 4H37A 3DTUB 4I5SA 5JWPA 3E8GA 2JIZG 1YI2V 4LF9B 4R7CA 5KUMA 2XASA 4K8XA 4WFBV 1SA0B 2V7QG 3SYPA 4X62B 3ABLC 3FB5C 1YJ9V 4O4JA 4JTAB 4PA7A 2DQ3A 3APOA 4E2LA 4JI5B 3C90A 4PA4A 3RFRA 5IJ0B 5B1AC 2Q67A 1HNXO 3MD0A 1KD1W 3FAVA 4O2AA 1FXKB 4JV5B 1K3EA 2YS8A 1S5HC 1RPRA 1Y67A 2X6BA 3SYQA 3KCXA 4TV8A 1FAFA 3L74H 1VF7A 1LNQA 3ZCCA 4OXSA 3MDSA 3DSQA 4YY3B 5JCOA 2ZE8A 1KKDA 4N21A 5B5EZ 1FFTB 3LDEA 3L9DA 2Z3YA 1V54B 3G4SV 4DV0B 3W7XA 1Q82W 4CS4A 3VQXA 2CGOA 1K7DA 1JOYA 3HKEB 2JS5A 3QO7A 1PD3A 2P06A 4B3RO 5LA6B 4D4PA 4D7SA 3EVKA 4NXNB 1NZ6A 4X1YA 2UXBO 2Q9LA 1FPOA 2QGNA 1ZL8A 4DW1A 2ZXWC 1Q5OA 2ZE5A 5JJJB 2E74B 2ZQMA 3B8NA 3SPJA 2PUSA 4LC1A 5DECA 4AI8A 4AQYO 1SC5B 3ABMB 5LBQA 4XDJA 3UM7A 1TVKB 2JJ1G 4P9OA 1FJGB 3JAMN 5EZYB 2W6IG 1AI7A 1NVPB 3BPZA 2JJ2G 4FLXA 3T1CA 5L3GA 1J5EB 1P49A 1RSOA 1QBZA 4I55A 5DN6G 1VQMV 2P5OA 1NTKH 4UCUA 1TUBB 1GK9A 3CXHF 1NR1A 1DTOA 3C3TA 2B9ZA 4X89A 1KB9F 3ASNC 3VQVA 1EN5A 3CRQA 4X1KA 3JAKA 3RGBA 1DLBA 2RMKB 1KMIZ 2E76B 2UUBB 4LNUA 1QLEC 3HKCA 4O4IA 4PI2A 2B1GA 3CCMV 4MVQA 1VQKV 3UQ8A 2ARHA 3LSSA 4F6EA 1MOFA 2ZR2A 4TUYB 4TWKA 5FLXN 3SDLA 1GN2A 4W4LA 4R6ZA 5IJ9B 1BS3A 4GUNA 4H33A 1R6KA 2CH7B 1SS3A 3E83A 2A06H 1FXHA 4LBEC 4MTOA 4DK0A 3BEHA 5LXTB 5JJNB 2ZT9B 3U0ZA 5IYZB 1XMOB 1KBHA 3OMAB 4B3TO 4F4LA 1G4YB 4ZIBA 2GSMB 2BSKB 5CBGA 1VQPV 1NH2B 1WP7A 4JI2O 2EIKC 1LR1A 1SQGA 2GBOA 2Z5UA 1K33A 4GKKB 4JASA 4RAIA 2Q0OC 3UCSC 1AP5A 3HB3B 1ZUQA 1FS0G 1S76D 1LUVA 1QR9A 4DR3B 4X33A 3LSQA 5BZBA 2Q68A 4CBCA 1J95A 4O4JB 4ABMA 2ADQB 4G27B 3VBBA 1D2DA 1OHHG 1VQ9V 4KHPO 5HFLA 4U3FH 3EHBB 2HVJC 4GX0A 1SZXA 3GB7C 4X66O 4DV2B 1H2NA 5KA5A 2YXYA 4LFCO 1NKDA 1ZTEA 4LF5B 2DN9A 4TV8B 4X20A 1KP3A 1Q6HA 5E1AC 3ASNB 1K34A 5BXZA 1Z5VA 4LWSA 2E75B 1NTMH 1QQCA 1XEQA 4LFAO 1B06A 1QLEB 3E8HA 2RDCA 4A5UB 4DUZO 4L87A 2Q0AA 2AZ2A 4DR4B 1H2MA 4JAAA 1YCIA 2UXNA 1GM7A 5EIBD 2KKWA 3DGEA 3ETEA 2VWKA 5H6RA 2PF4E 3R65A 4DR5B 3LUTB 4IT5A 4JZGA 4DV7B 4P9PA 4FK5C 2JEUA 2Q5ZA 1YF2A 3CWBH 1VQLV 4NTYA 5LOVA 1QVFU 1XL4A 3AG1B 4FZ0A 1UJWB 3QO8A 4X1YB 2YIBD 4F6RA 2M7WA 1ZSPA 1PV0A 1ZL8B 3THOA 1GRJA 3JCZA 3H1IH 5L3CA 5C8YB 3ZIAG 4HNAB 2B1IA 3CX5F 2XAJA 2QM4A 2R72A 4UUJC 4BR6A 2Q7GA 2Y69B 2EIKB 4WCEV 4DV6O 2CTPA 5IT9N 3H1LH 1NT2B 4KP4A 5ITZA 2JVDA 3W7TA 3ETQA 1NI8A 5JVDA 1RSOB 4Q6GA 3JSLA 4ZOLA 1XNRO 2IJJA 5EYPA 4JI7B 1EFRG 1AI6A 3ZRXA 2L35A 3H1JH 4DR2B 3JAKB 5B1OA 4YJ3A 1YDXA 2V1DA 2VQEB 5CA1A 3APQA 5IY5B 2N74A 4MS2A 4LNUB 3HKCB 5KLVH 4O4IB 4WFGA 2M6YA 1COWG 3OW2U 1HP8A 3B2EE 4H0LB 4GYCB 4QE9A 3BY6A 1B3QA 1FXVA 2QDOA 3ZMSA 1K92A 1QVGU 1NU1H 1Y76B 2UUCB 4WFAV 4YJ2A 4YIPA 2EZPA 2EIJC 3OGCC 4AILC 3OMIB 1A32A 4GKJB 2ITCC 5EC1C 4IHJA 1L8DA 1GMGA 2EIMC 5IYCO 3G71V 3FKSG 1ENVA 2G38A 2DQ0A 2ZIOA 4UCOA 4XBFA 3CCEV 3K57A 2UXCO 3CEIA 1VQ4V 1BL8A 1PNMA 1WPXA 5JQGA 5KX5A 1EM1A 4LF7O 3JCUZ 5H5NA 1OCZC 2BOBC 4MTGA 4W4KA 4HBNA 1GN4A 4JI8B 5JJEB 3K0GA 3E86A 2HEPA 5J2UA 2CUGA 1N33O 3ZMZA 3B8MA 2VWJA 1K8AW 3K5LA 2HP8A 5BMVA 3L75H 1JQ0A 1YOPA 3EFFK 5KMGA 4LF9O 1H8HG 3RYCA 4DR1B 3F5WC 1Q7YW 4X62O 1IBMB 1WNSA 4FFKA 5GW7A 2PI4A 3OMNB 5C93A 4KFMA 1NR7A 4JI5O 3W7UA 4PA9A 1VQ6V 2QR4A 1PL4A 4PA6A 3BHPA 4JV5O 1Y4MA 3NXSA 4GX2A 3JATA 1PNKA 2EZOA 4UVAA 5FPOA 2X7RB 4U7OA 4JYBA 1N4CA 3RBZA 2PTMA 2YIDA 2BCCH 1V54C 4J11A 1S3JA 2BTQA 3DC5A 4X20B 4DK1A 2FYUH 4YY3O 1UPGA 3BFRA 3JSNA 4B3SB 5D5QA 1OCCC 5KAIZ 4FIPC 4FM2A 5GTHZ 1BMFG 4RUFA 4DV0O 2JK5C 5EIBC 1OCOC 4I9QA 2YXHA 1IX9A 2QE7G 1K9MW 4LF4B 2JS3A 2XHBA 3E2EA 4MVSA 1U97A 3H1KH 2K1EA 4TSFG 3OUSA 2A9HA 3ABUA 3E8BA 2EIJB 2E5LB 4O4HA 1PP9H 4NXNO 4EB6A 5CA3A 2EIMB 1QR8A 3SGIA 5LOVB 1YXBA 5KAFZ 1XREA 1HDJA 5HFMA 3D36C 2XNDG 3PN1A 1VF6A 1K97A 3P3NA 5CMUA 5LYJA 4MVZA 3TK1A 4GLXA 3GWKC 3C3SA 4LF6B 4WBNA 2Q6AA 2NN4A 3P32A 1X59A 2JGDA 4P30A 1OCZB 5GONA 1FJGO 1AR5A 1K4DC 2W0FC 4O2BA 1KYOF 4J80A 3ZHVA 1SF9A 2OTLV 2ILMA 1J5EO 2WLLA 2P4KA 2W0XA 3BA9A 5ITZB 3RYIA 5KUKA 5FL7G 1AJQA 4DR6B 4QPJA 4CH6A 2XAHA 3S3XA 1TAEA 5JVDB 5BR8B 1P7BA 3CP1A 4ZOLB 4X88A 2KB1A 1V9PA 2UXXA 1HNZB 2UXDB 2A3QA 4I7ZB 2UUBO 5LGNA 4YIOA 2OYQA 1BZKA 4LH6A 4YJ3B 3P30A 1YZBA 2MK3A 2ZD9A 3CJHA 2RN9A 3B77A 1E1RG 3CCRV 2F4VB 1P4RA 4QIWF 1DF5A 4KL1A 1MZFA 4UXNA 1RM1C 1BQZA 1H2KA 1IVSA 3A0HZ 3SYOA 3M7MX 1N36B 1EZJA 2RJZA 4YJ2B 3K5NA 4FLYA 4BW9A 4FFBA 4DV1B 2PI5A 4IHJB 1OCCB 2Q69A 1SETA 1O9GA 1IBLB 4K8ZA 2P22C 3GWOA 1AJPA 1MZEA 1XMOO 2DMXA 3LNNA 1OCOB 2ZR3A 4NXMB 4X9QA 5KX5B 1YTFD 1VF5B 5CA0A 4NB5A 1JVMA 1N0NA 4GKKO 2CAZC 5FNVA 2IU3A 1GN3A 3I5DA 5J2UB 2ITDC 1OJHA 3AEIA 2KQXA 3DXRA 4UFZA 2IM9A 1H2LA
chains in the Genus database with same CATH topology
2EJ7A 1IURA 4D4OA 2CUGA 3APOA 4RWUA 1FAFA 3AG7A 2QWOB 2GUZA 4X33A 2CTWA 1YWSA 2JR7A 5AX2A 2QWNB 2CTQA 2LO1A 1WGEA 1XBLA 2CTPA 2OCHA 3UO2A 1YOPA 1GH6A 4D4PA 2DN9A 1BQ0A 2YS8A 2CTRA 2L6LA 2N05A 2Y4UA 1NZ6A 3APQA 1N4CA 2LGWA 2QWRB 2DMXA 2PF4E 2QSAA 1FPOA 2N04A 2QWQB 2QWPB 3BVOA 2KQXA 1WJZA 2GUZB 2YUAA 4IT5A 2M6YA 4J80A 3UCSC 1HDJA 4J7ZA 3UO3A 1BQZA 2Y4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ7 A;  1IUR A;  4D4O A;  2CUG A;  3APO A;  4RWU A;  1FAF A;  3AG7 A;  2QWO B;  2GUZ A;  4X33 A;  2CTW A;  1YWS A;  2JR7 A;  5AX2 A;  2QWN B;  2CTQ A;  2LO1 A;  1WGE A;  1XBL A;  2CTP A;  2OCH A;  3UO2 A;  1YOP A;  1GH6 A;  4D4P A;  2DN9 A;  1BQ0 A;  2YS8 A;  2CTR A;  2L6L A;  2N05 A;  2Y4U A;  1NZ6 A;  3APQ A;  1N4C A;  2LGW A;  2QWR B;  2DMX A;  2PF4 E;  2QSA A;  1FPO A;  2N04 A;  2QWQ B;  2QWP B;  3BVO A;  2KQX A;  1WJZ A;  2GUZ B;  2YUA A;  4IT5 A;  2M6Y A;  4J80 A;  3UCS C;  1HDJ A;  4J7Z A;  3UO3 A;  1BQZ A;  2Y4T A; 
#chains in the Genus database with same CATH topology
 5BMV B;  1JX9 A;  4DR3 O;  2X0L A;  4P2Z A;  5F2V O;  5KMG B;  4Z1M G;  2Y48 A;  3E22 A;  3RYC B;  1O9H A;  4O4L A;  1GM9 A;  1ZAU A;  1AP6 A;  2X6A A;  4LF8 B;  3F5T A;  4QGP A;  3Q4H A;  2GV9 A;  2IW5 A;  4R50 A;  3JAR B;  2PGG A;  2ZIM A;  5EBL C;  2ZNI A;  3ZRW A;  4DV2 O;  1MA1 A;  3CCS V;  4RWU A;  3JAT B;  5JCO C;  3W7W A;  1R1B A;  2HKO A;  4DV4 B;  1WAZ A;  3A8T A;  4LF5 O;  2QA4 V;  4LCU C;  4FVM A;  3STL C;  1VAR A;  3ZED A;  5H2F Z;  4JI4 B;  3JD1 A;  4FPP A;  3JAW B;  3HKB A;  3VOU A;  1YJN V;  2CGN A;  3H1H H;  2GDS A;  2AW9 A;  4DUY B;  1Y74 A;  2LGQ A;  1NS1 A;  4CH3 A;  4YHH B;  4LP8 A;  3AG1 C;  4DR4 O;  2ZDI A;  2YDE A;  4TQF A;  1FFX B;  5LGU A;  3WG7 C;  1EN6 A;  3JAS B;  2WWW A;  1RM1 B;  4DR5 O;  4DV7 O;  2QWR B;  2R9R B;  1QLN A;  5K1X A;  3MHS C;  5B1B C;  4LFB B;  4BAY A;  1XHX A;  1M4U A;  1SZT A;  3NR7 A;  4JGS A;  4HZ3 A;  4O4H B;  2ZE6 A;  2JR7 A;  1Q81 W;  3SJB C;  1EN4 A;  2K9P A;  1I08 A;  4EB6 B;  4CS2 A;  2Y69 C;  3CSX A;  2IJH A;  1ZX3 A;  2LW1 A;  1MMM A;  3FB6 C;  2EIL C;  1IXB A;  4RO2 A;  1SQQ H;  3T4D A;  1SKV A;  3RW0 A;  3IFX A;  3CME V;  4JI1 B;  1ROP A;  4WBN B;  4NKG B;  2QWO B;  1TUE B;  2JGD B;  5GON B;  3T1H B;  3J81 N;  3CCQ V;  2KG7 A;  3L73 H;  3T2M A;  2BOC C;  3H01 A;  5B66 Z;  1JFF A;  2WLL B;  2GTS A;  4OPH A;  1S5L Z;  3OM3 B;  3K5M A;  2HJF C;  5IY5 C;  1EBO A;  2Q7H A;  3M99 B;  3RYI B;  2YUA A;  3JAL A;  2EJ7 A;  4JI7 O;  1QU7 A;  5L3E A;  4I4T A;  2P90 A;  3FAV B;  3B40 A;  4O2A B;  1NJI W;  5DM6 V;  3ZHQ A;  4DW0 A;  3TET A;  3OGI B;  4DR2 O;  1XHZ A;  3UO2 A;  1L0L H;  1F23 A;  2JRI A;  1OCR C;  2BTO A;  2VQE O;  3OR6 C;  1TGO A;  1L0N H;  1S77 D;  4AHC A;  4EKW A;  3K9A A;  4JYY A;  1N8R W;  3G6E V;  3EXA A;  3RN4 A;  3WB1 A;  2EUL A;  2WA4 A;  2Y4T A;  1I0H A;  3CXC U;  3CJH B;  4FLU A;  3BCC H;  2UUC O;  2R9A A;  4CC5 A;  4K0K B;  4CC6 A;  1AIL A;  4GX5 A;  5J2T A;  3RYF A;  4CH5 A;  1SES A;  3LDC A;  1BQ0 A;  4GKJ O;  4TT3 G;  4FLW A;  5IDJ A;  1VQ5 V;  1NQT A;  4NVP A;  4DR7 B;  2DYR B;  2HHH B;  3AG3 C;  4GZR B;  2WLN A;  2FML A;  3ZHR A;  4ZI7 A;  2AXT Z;  2YXL A;  3CD6 V;  1BGY H;  3CC7 V;  3VQW A;  3B4S A;  2EBO A;  3ZBH A;  4EEQ A;  4CH4 A;  3WG7 B;  1Z5W A;  5KHI A;  1V55 C;  4JI8 O;  2PZS A;  1VQO V;  5B1B B;  4B7E A;  4J9Y B;  2F1M A;  3K58 A;  2VQF B;  2F23 A;  4JI0 B;  4PEL A;  4MW3 A;  3D3I A;  4YXW G;  3H9V A;  2LP7 A;  5FNV B;  1PNL A;  1G1X B;  1R3I C;  3F7Y C;  3RYH A;  1SQP H;  4X65 B;  4DRX A;  5IWA B;  3DXR B;  4DR1 O;  2EIL B;  1R3K C;  5A9G A;  1S72 V;  2L6L A;  2OTJ V;  1IBM O;  3RVY A;  4PDM A;  3SYA A;  4WFE A;  1MNG A;  1KUQ A;  2DWE C;  3IAY A;  3SPI A;  2HG5 C;  3E22 B;  4UCR A;  1KP2 A;  4G28 B;  4I55 B;  4FM1 A;  1VMG A;  5CB4 A;  4UCS A;  1GTO A;  1YVW A;  3CCV V;  3KG2 A;  2HR3 A;  1E79 G;  3Q4H B;  3CMA V;  5IJ0 A;  1HNW B;  4FMT A;  4X1K B;  2WLJ A;  2RCV A;  1AI4 A;  3QNE A;  4D7T A;  3AG4 C;  1FXK A;  2XT9 A;  1KC8 W;  2H3O A;  2RNB A;  2ZE7 A;  1B6Q A;  2YI8 A;  1BCC H;  3N2G A;  4QE7 A;  2LFS A;  1YWS A;  2XAQ A;  1I7F A;  4B3S O;  4X64 B;  2IJI A;  3S3W A;  1ORQ C;  1BHB A;  1W2B U;  1OCR B;  1PL0 A;  3HKB B;  5B1N A;  2UU9 B;  1Y6X A;  1CPY A;  1JPX A;  3ASO C;  5KHG A;  1Y74 B;  3X2Q B;  2VRZ A;  2IJK A;  1PM9 A;  3K04 A;  3IGA C;  4IL6 Z;  4LH7 A;  1AB3 A;  3BRC A;  4LF4 O;  5B3S C;  3AG7 A;  4J7J A;  2GTA A;  1SER A;  5CN0 A;  1UFI A;  5K1P A;  2E5L O;  2PYJ A;  2YIC A;  2WLK A;  3HKD A;  3P3P A;  4GCZ A;  2YI9 A;  4BW5 A;  5LP6 A;  3K59 A;  4DXW A;  2UUA B;  2OWO A;  1U96 A;  5LHI A;  3ZX6 A;  2QM7 A;  5LHH A;  4JYA O;  2N04 A;  3AG3 B;  2IU0 A;  4UV9 A;  5LL6 Y;  2PYL A;  3JD3 A;  3ICX A;  3ZMV A;  4LF6 O;  1S0V A;  3SJC C;  1YTF B;  3OR7 C;  2LQT A;  1V55 B;  3LSU A;  4MVU A;  3O65 A;  2WLM A;  1AI5 A;  4X8A A;  5IYD O;  1M90 W;  1IDS A;  1R73 A;  1X4T A;  5LMN B;  2FTK A;  4GT1 A;  2ZM6 B;  3OE7 G;  2IBZ H;  2KG7 B;  4ICG A;  1HR0 B;  4DR6 O;  1JFF B;  3DC6 A;  5BR8 O;  2OCH A;  5BY1 A;  3CC4 V;  4JZ2 A;  1R3L C;  3JAL B;  1HNZ O;  1QHT A;  2UXD O;  4I4T B;  3FYE B;  2HVK C;  4I50 A;  3JYC A;  3STZ C;  1ZLZ A;  3K06 A;  1DK1 A;  5H9C A;  4BIU A;  4J10 A;  2EX3 A;  3CC2 V;  1D5A A;  5CBH A;  3FB8 C;  1F7Y A;  1Q6U A;  3OEH G;  1K5Q A;  5AG2 A;  5EK0 A;  4UVB A;  2F4V O;  1XBL A;  4K35 A;  4CZZ A;  1VEW A;  1W0K G;  1THZ A;  1WN7 A;  4LWS B;  2C2A A;  5LGT A;  3T1Y B;  2XOK G;  4KXR A;  1XNQ B;  3AG4 B;  2AGA A;  2QWP B;  4PV1 B;  3OUF A;  1N36 O;  1M1K W;  1PKX A;  2NNU A;  1P84 F;  1M56 B;  4DV3 B;  5J2T B;  3RYF B;  4TUY A;  1LUW A;  4DV1 O;  4B3M B;  2OT5 A;  2P6J A;  1XIL A;  1IBL O;  2OIG A;  2CH7 A;  4PJ0 Z;  1H2G A;  1WA8 A;  4ZI7 B;  2N05 A;  1NBM G;  3T4Z A;  3LDD A;  4TV9 A;  2DE0 X;  3ASO B;  4UV8 A;  4L8J A;  1N32 B;  5LXT A;  4NXM O;  4JYA B;  3RT3 C;  5IYZ A;  5B3S B;  4DV5 B;  2E3C A;  2H94 A;  4F6R B;  2CTW A;  1URF A;  2CTQ A;  2BSK A;  2ETN A;  4MTX A;  5LMU B;  2WLH A;  4DO2 A;  3I56 V;  4IYI A;  3E89 A;  4RQF A;  4PDR A;  1GN6 A;  2PY5 A;  2EIN B;  2DYS B;  3O9O A;  3OTO B;  2YC0 A;  4OPA A;  3RWR D;  1N0J A;  1CEZ A;  3R66 A;  4WFF A;  1VP7 A;  2P4V A;  4Z1V A;  3A2F A;  4NTW A;  4JYC A;  4IYH A;  4KUM A;  4LF8 O;  3IC7 A;  3RVZ A;  1MSW D;  5CB4 B;  4PI0 A;  4QPK A;  4LR3 A;  1SQF A;  5EYP B;  1XI1 A;  2QKC A;  3ABK C;  4D6T H;  2DWD C;  4DV4 O;  1GAX A;  1XUQ A;  1G8M A;  5CA1 B;  1I94 B;  3AG2 B;  5EBM C;  5H6Q A;  2FB5 A;  2F95 B;  5JH7 A;  4JI4 O;  4JI6 B;  1IBK O;  3CB2 A;  4WF9 V;  2ATK C;  3AK3 A;  3WFV A;  1AVM A;  1K5S A;  4G2K A;  1K4C C;  3N2G B;  3TCU A;  2QEX V;  3TGU H;  4B08 A;  4CS3 A;  3OD4 A;  1OZ0 A;  2CE4 A;  4DUY O;  3L70 H;  4YHH O;  1VQ8 V;  4H13 B;  4JAU A;  1RFY A;  2OCC C;  1R6N A;  3AK2 A;  2QKA A;  4UB6 Z;  2V4D A;  1SQV H;  1F4N A;  3A0R A;  3BVO A;  1VF6 C;  1YIJ V;  4LFB O;  1HWY A;  3MAQ A;  1M9N A;  1BT8 A;  3OEE G;  2F66 C;  3HKD B;  1MG1 A;  1WPB A;  5JQG B;  5LP6 B;  4OX9 B;  1MAB G;  1B04 A;  1F51 A;  2YEV A;  1HW7 A;  2QJ1 A;  1KQS U;  1VIB A;  4I0X A;  1XMQ B;  2AHZ A;  2QM8 A;  3B09 A;  1N34 B;  2W6J G;  1VQ7 V;  2QWQ B;  4MVM A;  4JAV A;  2HJD A;  2ZCE A;  3CRR A;  4JI1 O;  4FJC C;  1ZWI C;  4FLZ A;  3SPH A;  3T1H O;  2MW2 B;  3QO5 A;  2GUZ A;  5C8Y A;  4HNA A;  4GX1 A;  1WP8 A;  2X6C A;  4UCV A;  4U7N A;  3SJQ C;  3BAB A;  1QNM A;  2LJ2 A;  2P67 A;  4MW8 A;  3GVM A;  3N27 A;  3W7S A;  5LHG A;  3G67 A;  2Z0A A;  3UO3 A;  4DYL A;  5FPR A;  1IUR A;  1FYJ A;  1RPO A;  2QTO A;  1YJW V;  5GTI Z;  1HNX B;  2HFE C;  3L71 H;  4I50 B;  3WU2 Z;  4J42 A;  1XOU A;  5D5P A;  1IBK B;  3ABL B;  3K79 A;  2LGW A;  2EJR A;  3SPG A;  4B7K A;  1M57 C;  2DYR C;  3ABK B;  3N2K A;  2BTQ B;  3SR2 C;  2RQ6 A;  4UCT A;  5B1A B;  1P7G A;  3KKY A;  3D3Q A;  4K0K O;  2H8P C;  1I5Y A;  3ZRV A;  3F7V C;  4ZHQ A;  1YIT V;  3ETG A;  1DF4 A;  1S5J A;  1Y76 A;  2NR5 A;  1XQ8 A;  4DR7 O;  3CCJ V;  2HHH O;  2Q4P A;  4E4E A;  3FB7 C;  3WB0 A;  2ODM A;  4PDL A;  1JJ2 U;  4FLT A;  1JR9 A;  3IC9 A;  3CCL V;  4FLV A;  2OCC B;  4B3R B;  1WA8 B;  5AX2 A;  5DED A;  3VQY A;  4RQE A;  4MVR A;  4TV9 B;  2OIE A;  1WB8 A;  4R8C A;  2HLD G;  2Y4U A;  5L3F A;  3D8C A;  5L3B A;  3JD2 A;  2VQF O;  2UXB B;  5LYJ B;  1WJZ A;  4JI0 O;  3ZHS A;  1OV9 A;  3FX7 A;  3QG5 A;  3BA8 A;  3K3W A;  2LW7 A;  1F4M A;  5J9P C;  3M8A A;  4AQY B;  4OGQ B;  4X65 O;  5IWA O;  4EFE A;  1M5I A;  4O2B B;  1ARO P;  4J7K A;  3BAA A;  4JI3 O;  4QJF B;  3ZJZ A;  3UKM A;  2ZXW B;  1BE3 H;  2WPD G;  3I55 V;  4JPR A;  1Q6I A;  4D4O A;  2CK3 G;  2IH3 C;  5A2Q N;  2DOS A;  3G80 A;  1GM8 A;  1H38 A;  2JDI G;  3K03 A;  1XL6 A;  1HNW O;  5KHH A;  1GH6 A;  5KA6 A;  4C7U A;  1KKC A;  1VQN V;  5L3D A;  3FD9 A;  1H8E G;  3E35 A;  1NTZ H;  2XAG A;  4J7Z A;  1R6T A;  3E8F A;  3X2Q C;  3G6B A;  2WAM A;  1G6U A;  2ZDI C;  1R3J C;  2B5U A;  5JH7 B;  2R9I A;  3PJS K;  4X64 O;  2ZNJ A;  3U10 A;  4J41 A;  4NYK A;  2UU9 O;  3IJ4 A;  3CCU V;  1JJO A;  3CRC A;  1BSM A;  4MVO A;  1IZ3 A;  1E1Q G;  4ZKI A;  3CE2 A;  1JMK C;  1M57 B;  4N23 A;  3K5O A;  4JTD B;  3UT5 A;  5CBF A;  4FFB B;  1IXM A;  3CHX A;  1JA8 A;  1TA8 A;  4U3J A;  3LNM B;  2Y0I A;  2UUA O;  4QNH B;  2WLI A;  3CPW U;  1T5E A;  2JGU A;  3OTF A;  4NTX A;  1M93 A;  4X1I A;  2AZ0 A;  1FD9 A;  2YEV B;  5CA0 B;  2O57 A;  4B3T B;  4PHZ A;  1AR4 A;  4I0X B;  3ZS8 C;  4JI2 B;  4NR1 A;  4IIJ A;  1RP3 B;  1NVP D;  3HPL C;  4I9W A;  5LMN O;  2IH1 C;  1FKA O;  2GUZ B;  4JI3 B;  2ZM6 O;  2JEX A;  1HR0 O;  1SA0 A;  1EZV H;  1Q43 A;  4O4L B;  5EC2 C;  3AK1 A;  3SYC A;  3SJA C;  3A0B Z;  1GKF A;  3J7A U;  3ZRW B;  5TIS Z;  4K3A A;  4XDL A;  1L1F A;  3ZMT A;  4PA3 A;  3SPC A;  4KHP B;  4J9Z B;  2QKS A;  1Q86 W;  1M56 C;  4X66 B;  3ZMU A;  1US6 A;  2WA3 A;  3FFQ A;  1MSD A;  1AJN A;  4LFC B;  3KCY A;  3JD4 A;  2A79 B;  3T1Y O;  4JF3 A;  3N2K B;  2CTR A;  1XNQ O;  1KU9 A;  4HAM A;  2XTA A;  3CS5 A;  4ZBM A;  4PD4 F;  4WFH A;  3TJT A;  3K08 A;  5KHK A;  4FZ1 A;  4DV3 O;  1Q3E A;  4ZHQ B;  4JTC B;  4BWA A;  4LFA B;  2P7T C;  4B3M O;  1SQX H;  4DUZ B;  2NLJ C;  3HKE A;  3QTC A;  4EFB A;  2CDY A;  2ZIN A;  1BHA A;  1SQB H;  3HR0 A;  1H2S B;  2Q7E A;  1WLE A;  2Q8V A;  5LA6 A;  1N32 O;  3ABT A;  2WSS G;  2LFR A;  2R70 A;  3TXS A;  3ZHT A;  3TXQ A;  4DV5 O;  2FKX A;  4UVC A;  2EIN C;  1NH2 D;  2DYS C;  2A7W A;  2XUM A;  3U11 A;  1CXZ B;  1Z2G A;  1PPJ H;  5LMU O;  2A0L A;  2QTS A;  2ZKO A;  3ETD A;  3K9S A;  4ASU G;  4UB8 Z;  4MT8 A;  2YIB A;  1TVK A;  3OTO O;  3CRM A;  1DGS A;  1CP9 A;  1YSC A;  5EZY A;  3D36 A;  2DW4 A;  2AHY A;  3FYI B;  1WGE A;  4BIZ A;  3OFN G;  4DV6 B;  2D3O W;  2F43 G;  1XDC A;  3AG2 C;  1FXK C;  2F93 B;  3QVN A;  2XAF A;  1W59 A;  4PDV A;  2Y0P A;  2GHY A;  1TUB A;  1AR1 B;  5KHJ A;  1K73 W;  1WB7 A;  5E79 Z;  2VS0 A;  3JAR A;  3CRA A;  3J80 N;  1XNR B;  3MHH C;  1I94 O;  2YSU B;  3ML0 A;  2LO1 A;  4H44 B;  4BIO A;  4JI6 O;  3ZHU A;  4Z2W A;  5IYB O;  3JD0 A;  3WB2 A;  1YHQ V;  3JAW A;  4MTF A;  5EBW C;  1KEC A;  5LP6 C;  1SRY A;  2DJV A;  3L72 H;  4IGG A;  5IJ9 A;  3OAA G;  3ZN1 A;  1QCE A;  4TOI A;  3UT5 B;  3QF7 A;  4XDK A;  2D2C B;  4RUE A;  1FFX A;  1Q8I A;  3KZI Z;  3ZN0 A;  2Q73 A;  2YIA A;  1JCH A;  4U3J B;  3JAS A;  4Q20 A;  3OT7 A;  4OX9 O;  3ZRS A;  1Y66 A;  2WLI B;  1W0J G;  5IE9 A;  1D5N A;  1GO3 F;  3ABM C;  3K0D A;  2UXC B;  1XMQ O;  4X1I B;  1I5X A;  2FL4 A;  1N34 O;  4LF7 B;  1Q90 D;  2QSA A;  3CYO A;  4FM0 A;  2ADP A;  2KSD A;  4TQD A;  4MSW C;  2BE3 A;  4HYO A;  1N33 B;  3RYH B;  4DRX B;  1YEW A;  4IIJ B;  2QWN B;  4H37 A;  3DTU B;  4I5S A;  5JWP A;  3E8G A;  2JIZ G;  1YI2 V;  4LF9 B;  4R7C A;  5KUM A;  2XAS A;  4K8X A;  4WFB V;  1SA0 B;  2V7Q G;  3SYP A;  4X62 B;  3ABL C;  3FB5 C;  1YJ9 V;  4O4J A;  4JTA B;  4PA7 A;  2DQ3 A;  3APO A;  4E2L A;  4JI5 B;  3C90 A;  4PA4 A;  3RFR A;  5IJ0 B;  5B1A C;  2Q67 A;  1HNX O;  3MD0 A;  1KD1 W;  3FAV A;  4O2A A;  1FXK B;  4JV5 B;  1K3E A;  2YS8 A;  1S5H C;  1RPR A;  1Y67 A;  2X6B A;  3SYQ A;  3KCX A;  4TV8 A;  1FAF A;  3L74 H;  1VF7 A;  1LNQ A;  3ZCC A;  4OXS A;  3MDS A;  3DSQ A;  4YY3 B;  5JCO A;  2ZE8 A;  1KKD A;  4N21 A;  5B5E Z;  1FFT B;  3LDE A;  3L9D A;  2Z3Y A;  1V54 B;  3G4S V;  4DV0 B;  3W7X A;  1Q82 W;  4CS4 A;  3VQX A;  2CGO A;  1K7D A;  1JOY A;  3HKE B;  2JS5 A;  3QO7 A;  1PD3 A;  2P06 A;  4B3R O;  5LA6 B;  4D4P A;  4D7S A;  3EVK A;  4NXN B;  1NZ6 A;  4X1Y A;  2UXB O;  2Q9L A;  1FPO A;  2QGN A;  1ZL8 A;  4DW1 A;  2ZXW C;  1Q5O A;  2ZE5 A;  5JJJ B;  2E74 B;  2ZQM A;  3B8N A;  3SPJ A;  2PUS A;  4LC1 A;  5DEC A;  4AI8 A;  4AQY O;  1SC5 B;  3ABM B;  5LBQ A;  4XDJ A;  3UM7 A;  1TVK B;  2JJ1 G;  4P9O A;  1FJG B;  3JAM N;  5EZY B;  2W6I G;  1AI7 A;  1NVP B;  3BPZ A;  2JJ2 G;  4FLX A;  3T1C A;  5L3G A;  1J5E B;  1P49 A;  1RSO A;  1QBZ A;  4I55 A;  5DN6 G;  1VQM V;  2P5O A;  1NTK H;  4UCU A;  1TUB B;  1GK9 A;  3CXH F;  1NR1 A;  1DTO A;  3C3T A;  2B9Z A;  4X89 A;  1KB9 F;  3ASN C;  3VQV A;  1EN5 A;  3CRQ A;  4X1K A;  3JAK A;  3RGB A;  1DLB A;  2RMK B;  1KMI Z;  2E76 B;  2UUB B;  4LNU A;  1QLE C;  3HKC A;  4O4I A;  4PI2 A;  2B1G A;  3CCM V;  4MVQ A;  1VQK V;  3UQ8 A;  2ARH A;  3LSS A;  4F6E A;  1MOF A;  2ZR2 A;  4TUY B;  4TWK A;  5FLX N;  3SDL A;  1GN2 A;  4W4L A;  4R6Z A;  5IJ9 B;  1BS3 A;  4GUN A;  4H33 A;  1R6K A;  2CH7 B;  1SS3 A;  3E83 A;  2A06 H;  1FXH A;  4LBE C;  4MTO A;  4DK0 A;  3BEH A;  5LXT B;  5JJN B;  2ZT9 B;  3U0Z A;  5IYZ B;  1XMO B;  1KBH A;  3OMA B;  4B3T O;  4F4L A;  1G4Y B;  4ZIB A;  2GSM B;  2BSK B;  5CBG A;  1VQP V;  1NH2 B;  1WP7 A;  4JI2 O;  2EIK C;  1LR1 A;  1SQG A;  2GBO A;  2Z5U A;  1K33 A;  4GKK B;  4JAS A;  4RAI A;  2Q0O C;  3UCS C;  1AP5 A;  3HB3 B;  1ZUQ A;  1FS0 G;  1S76 D;  1LUV A;  1QR9 A;  4DR3 B;  4X33 A;  3LSQ A;  5BZB A;  2Q68 A;  4CBC A;  1J95 A;  4O4J B;  4ABM A;  2ADQ B;  4G27 B;  3VBB A;  1D2D A;  1OHH G;  1VQ9 V;  4KHP O;  5HFL A;  4U3F H;  3EHB B;  2HVJ C;  4GX0 A;  1SZX A;  3GB7 C;  4X66 O;  4DV2 B;  1H2N A;  5KA5 A;  2YXY A;  4LFC O;  1NKD A;  1ZTE A;  4LF5 B;  2DN9 A;  4TV8 B;  4X20 A;  1KP3 A;  1Q6H A;  5E1A C;  3ASN B;  1K34 A;  5BXZ A;  1Z5V A;  4LWS A;  2E75 B;  1NTM H;  1QQC A;  1XEQ A;  4LFA O;  1B06 A;  1QLE B;  3E8H A;  2RDC A;  4A5U B;  4DUZ O;  4L87 A;  2Q0A A;  2AZ2 A;  4DR4 B;  1H2M A;  4JAA A;  1YCI A;  2UXN A;  1GM7 A;  5EIB D;  2KKW A;  3DGE A;  3ETE A;  2VWK A;  5H6R A;  2PF4 E;  3R65 A;  4DR5 B;  3LUT B;  4IT5 A;  4JZG A;  4DV7 B;  4P9P A;  4FK5 C;  2JEU A;  2Q5Z A;  1YF2 A;  3CWB H;  1VQL V;  4NTY A;  5LOV A;  1QVF U;  1XL4 A;  3AG1 B;  4FZ0 A;  1UJW B;  3QO8 A;  4X1Y B;  2YIB D;  4F6R A;  2M7W A;  1ZSP A;  1PV0 A;  1ZL8 B;  3THO A;  1GRJ A;  3JCZ A;  3H1I H;  5L3C A;  5C8Y B;  3ZIA G;  4HNA B;  2B1I A;  3CX5 F;  2XAJ A;  2QM4 A;  2R72 A;  4UUJ C;  4BR6 A;  2Q7G A;  2Y69 B;  2EIK B;  4WCE V;  4DV6 O;  2CTP A;  5IT9 N;  3H1L H;  1NT2 B;  4KP4 A;  5ITZ A;  2JVD A;  3W7T A;  3ETQ A;  1NI8 A;  5JVD A;  1RSO B;  4Q6G A;  3JSL A;  4ZOL A;  1XNR O;  2IJJ A;  5EYP A;  4JI7 B;  1EFR G;  1AI6 A;  3ZRX A;  2L35 A;  3H1J H;  4DR2 B;  3JAK B;  5B1O A;  4YJ3 A;  1YDX A;  2V1D A;  2VQE B;  5CA1 A;  3APQ A;  5IY5 B;  2N74 A;  4MS2 A;  4LNU B;  3HKC B;  5KLV H;  4O4I B;  4WFG A;  2M6Y A;  1COW G;  3OW2 U;  1HP8 A;  3B2E E;  4H0L B;  4GYC B;  4QE9 A;  3BY6 A;  1B3Q A;  1FXV A;  2QDO A;  3ZMS A;  1K92 A;  1QVG U;  1NU1 H;  1Y76 B;  2UUC B;  4WFA V;  4YJ2 A;  4YIP A;  2EZP A;  2EIJ C;  3OGC C;  4AIL C;  3OMI B;  1A32 A;  4GKJ B;  2ITC C;  5EC1 C;  4IHJ A;  1L8D A;  1GMG A;  2EIM C;  5IYC O;  3G71 V;  3FKS G;  1ENV A;  2G38 A;  2DQ0 A;  2ZIO A;  4UCO A;  4XBF A;  3CCE V;  3K57 A;  2UXC O;  3CEI A;  1VQ4 V;  1BL8 A;  1PNM A;  1WPX A;  5JQG A;  5KX5 A;  1EM1 A;  4LF7 O;  3JCU Z;  5H5N A;  1OCZ C;  2BOB C;  4MTG A;  4W4K A;  4HBN A;  1GN4 A;  4JI8 B;  5JJE B;  3K0G A;  3E86 A;  2HEP A;  5J2U A;  2CUG A;  1N33 O;  3ZMZ A;  3B8M A;  2VWJ A;  1K8A W;  3K5L A;  2HP8 A;  5BMV A;  3L75 H;  1JQ0 A;  1YOP A;  3EFF K;  5KMG A;  4LF9 O;  1H8H G;  3RYC A;  4DR1 B;  3F5W C;  1Q7Y W;  4X62 O;  1IBM B;  1WNS A;  4FFK A;  5GW7 A;  2PI4 A;  3OMN B;  5C93 A;  4KFM A;  1NR7 A;  4JI5 O;  3W7U A;  4PA9 A;  1VQ6 V;  2QR4 A;  1PL4 A;  4PA6 A;  3BHP A;  4JV5 O;  1Y4M A;  3NXS A;  4GX2 A;  3JAT A;  1PNK A;  2EZO A;  4UVA A;  5FPO A;  2X7R B;  4U7O A;  4JYB A;  1N4C A;  3RBZ A;  2PTM A;  2YID A;  2BCC H;  1V54 C;  4J11 A;  1S3J A;  2BTQ A;  3DC5 A;  4X20 B;  4DK1 A;  2FYU H;  4YY3 O;  1UPG A;  3BFR A;  3JSN A;  4B3S B;  5D5Q A;  1OCC C;  5KAI Z;  4FIP C;  4FM2 A;  5GTH Z;  1BMF G;  4RUF A;  4DV0 O;  2JK5 C;  5EIB C;  1OCO C;  4I9Q A;  2YXH A;  1IX9 A;  2QE7 G;  1K9M W;  4LF4 B;  2JS3 A;  2XHB A;  3E2E A;  4MVS A;  1U97 A;  3H1K H;  2K1E A;  4TSF G;  3OUS A;  2A9H A;  3ABU A;  3E8B A;  2EIJ B;  2E5L B;  4O4H A;  1PP9 H;  4NXN O;  4EB6 A;  5CA3 A;  2EIM B;  1QR8 A;  3SGI A;  5LOV B;  1YXB A;  5KAF Z;  1XRE A;  1HDJ A;  5HFM A;  3D36 C;  2XND G;  3PN1 A;  1VF6 A;  1K97 A;  3P3N A;  5CMU A;  5LYJ A;  4MVZ A;  3TK1 A;  4GLX A;  3GWK C;  3C3S A;  4LF6 B;  4WBN A;  2Q6A A;  2NN4 A;  3P32 A;  1X59 A;  2JGD A;  4P30 A;  1OCZ B;  5GON A;  1FJG O;  1AR5 A;  1K4D C;  2W0F C;  4O2B A;  1KYO F;  4J80 A;  3ZHV A;  1SF9 A;  2OTL V;  2ILM A;  1J5E O;  2WLL A;  2P4K A;  2W0X A;  3BA9 A;  5ITZ B;  3RYI A;  5KUK A;  5FL7 G;  1AJQ A;  4DR6 B;  4QPJ A;  4CH6 A;  2XAH A;  3S3X A;  1TAE A;  5JVD B;  5BR8 B;  1P7B A;  3CP1 A;  4ZOL B;  4X88 A;  2KB1 A;  1V9P A;  2UXX A;  1HNZ B;  2UXD B;  2A3Q A;  4I7Z B;  2UUB O;  5LGN A;  4YIO A;  2OYQ A;  1BZK A;  4LH6 A;  4YJ3 B;  3P30 A;  1YZB A;  2MK3 A;  2ZD9 A;  3CJH A;  2RN9 A;  3B77 A;  1E1R G;  3CCR V;  2F4V B;  1P4R A;  4QIW F;  1DF5 A;  4KL1 A;  1MZF A;  4UXN A;  1RM1 C;  1BQZ A;  1H2K A;  1IVS A;  3A0H Z;  3SYO A;  3M7M X;  1N36 B;  1EZJ A;  2RJZ A;  4YJ2 B;  3K5N A;  4FLY A;  4BW9 A;  4FFB A;  4DV1 B;  2PI5 A;  4IHJ B;  1OCC B;  2Q69 A;  1SET A;  1O9G A;  1IBL B;  4K8Z A;  2P22 C;  3GWO A;  1AJP A;  1MZE A;  1XMO O;  2DMX A;  3LNN A;  1OCO B;  2ZR3 A;  4NXM B;  4X9Q A;  5KX5 B;  1YTF D;  1VF5 B;  5CA0 A;  4NB5 A;  1JVM A;  1N0N A;  4GKK O;  2CAZ C;  5FNV A;  2IU3 A;  1GN3 A;  3I5D A;  5J2U B;  2ITD C;  1OJH A;  3AEI A;  2KQX A;  3DXR A;  4UFZ A;  2IM9 A;  1H2L A; 
#chains in the Genus database with same CATH homology
 2EJ7 A;  1IUR A;  4D4O A;  2CUG A;  3APO A;  4RWU A;  1FAF A;  3AG7 A;  2QWO B;  2GUZ A;  4X33 A;  2CTW A;  1YWS A;  2JR7 A;  5AX2 A;  2QWN B;  2CTQ A;  2LO1 A;  1WGE A;  1XBL A;  2CTP A;  2OCH A;  3UO2 A;  1YOP A;  1GH6 A;  4D4P A;  2DN9 A;  1BQ0 A;  2YS8 A;  2CTR A;  2L6L A;  2N05 A;  2Y4U A;  1NZ6 A;  3APQ A;  1N4C A;  2LGW A;  2QWR B;  2DMX A;  2PF4 E;  2QSA A;  1FPO A;  2N04 A;  2QWQ B;  2QWP B;  3BVO A;  2KQX A;  1WJZ A;  2GUZ B;  2YUA A;  4IT5 A;  2M6Y A;  4J80 A;  3UCS C;  1HDJ A;  4J7Z A;  3UO3 A;  1BQZ A;  2Y4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...