The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
142
|
structure length |
142
|
Chain Sequence |
MVYKITVRVYQTNPDAFFHPVEKTVWKYANGGTWSITDDQHVLTMGGSGTSGTLRFHADNGESFTATFGVHNYKRWCDIVTNLAADETGMVINQQYYSQKNREEARERQLSNYQVKNAKGRNFQIVYTEAEGNDLHANLIIG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular Cloning, Carbohydrate Specificity and the Crystal Structure of Two Sclerotium rolfsii Lectin Variants.
pubmed doi rcsb |
| molecule keywords |
Sclerotium Rolfsii lectin variant
|
| molecule tags |
Sugar binding protein
|
| source organism |
Athelia rolfsii
|
| total genus |
40
|
| structure length |
142
|
| sequence length |
142
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2015-03-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07367 | FB_lectin | Fungal fruit body lectin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Mutm (Fpg) Protein; Chain: A, domain 2 | Cytolysin/lectin |
#chains in the Genus database with same CATH superfamily 2L2B A; 4TSY A; 1Y2U A; 1KD6 A; 1IAZ A; 3LIM A; 3QDS A; 1GWY A; 4YLD A; 4Z2F A; 3QDW A; 2OFE A; 1Y2T A; 3ZWG A; 1Y2W A; 1O71 A; 3QDV A; 3ZWJ A; 1TZQ A; 4TSL A; 2KS4 A; 3QDT A; 3W9P A; 3VWI A; 3QDY A; 4Z2S A; 1X99 A; 1Y2V A; 4TSO A; 3QDX A; 2OFC A; 1O72 A; 4WDC A; 2OFD A; 1Y2X A; 4TSP A; 1XI0 A; 5BPG A; 2L38 A; 3QDU A; 4TSN A; 4Z2Q A; 4TSQ A; #chains in the Genus database with same CATH topology 4WX5 A; 2L2B A; 4TSY A; 1Y2U A; 4P1W B; 1IAZ A; 1KD6 A; 4WX3 A; 3LIM A; 3QDS A; 1GWY A; 4YLD A; 4Z2F A; 5JHF B; 3QDW A; 4HPQ B; 3A57 A; 2OFE A; 1Y2T A; 4JOX A; 3ZWG A; 1Y2W A; 1O71 A; 3QDV A; 3ZWJ A; 1TZQ A; 4TSL A; 2KS4 A; 3QDT A; 3W9P A; 3VWI A; 3QDY A; 4Z2S A; 1X99 A; 1Y2V A; 4TSO A; 3QDX A; 2OFC A; 4OEB A; 1O72 A; 4WDC A; 2OFD A; 1Y2X A; 4TSP A; 1XI0 A; 5BPG A; 2L38 A; 3QDU A; 4TSN A; 4Z2Q A; 4TSQ A; #chains in the Genus database with same CATH homology 2L2B A; 4TSY A; 1Y2U A; 1KD6 A; 1IAZ A; 3LIM A; 3QDS A; 1GWY A; 4YLD A; 4Z2F A; 3QDW A; 2OFE A; 1Y2T A; 3ZWG A; 1Y2W A; 1O71 A; 3QDV A; 3ZWJ A; 1TZQ A; 4TSL A; 2KS4 A; 3QDT A; 3W9P A; 3VWI A; 3QDY A; 4Z2S A; 1X99 A; 1Y2V A; 4TSO A; 3QDX A; 2OFC A; 1O72 A; 4WDC A; 2OFD A; 1Y2X A; 4TSP A; 1XI0 A; 5BPG A; 2L38 A; 3QDU A; 4TSN A; 4Z2Q A; 4TSQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...